BLASTX nr result
ID: Bupleurum21_contig00037230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037230 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522297.1| Xylem serine proteinase 1 precursor, putativ... 87 1e-15 ref|XP_002269555.2| PREDICTED: subtilisin-like protease-like [Vi... 85 7e-15 emb|CBI30770.3| unnamed protein product [Vitis vinifera] 85 7e-15 ref|XP_002269375.1| PREDICTED: subtilisin-like protease-like [Vi... 85 7e-15 emb|CAN61728.1| hypothetical protein VITISV_036029 [Vitis vinifera] 85 7e-15 >ref|XP_002522297.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] gi|223538550|gb|EEF40155.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis] Length = 776 Score = 87.0 bits (214), Expect = 1e-15 Identities = 42/58 (72%), Positives = 45/58 (77%) Frame = -1 Query: 175 AYSAQTKVYTVYLGNHSGEKTLHEIEESHHSYLFSVKKTEEEARTSLLYSYKNIFNGF 2 A Q KVY VY G HSG+K LHEIEE+H SYLFSVK+TE EAR SLLYSYKN NGF Sbjct: 16 ASCVQKKVYIVYFGEHSGDKALHEIEETHVSYLFSVKETEREARDSLLYSYKNSINGF 73 >ref|XP_002269555.2| PREDICTED: subtilisin-like protease-like [Vitis vinifera] Length = 777 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -1 Query: 175 AYSAQTKVYTVYLGNHSGEKTLHEIEESHHSYLFSVKKTEEEARTSLLYSYKNIFNGF 2 A A+ KVY VY G HSG+K LHEIE+ HHSYL SVK +EEEAR SLLYSYK+ NGF Sbjct: 16 ASCAERKVYIVYFGEHSGQKALHEIEDYHHSYLLSVKASEEEARDSLLYSYKHSINGF 73 >emb|CBI30770.3| unnamed protein product [Vitis vinifera] Length = 740 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -1 Query: 175 AYSAQTKVYTVYLGNHSGEKTLHEIEESHHSYLFSVKKTEEEARTSLLYSYKNIFNGF 2 A A+ KVY VY G HSG+K LHEIE+ HHSYL SVK +EEEAR SLLYSYK+ NGF Sbjct: 16 ASCAERKVYIVYFGGHSGQKALHEIEDYHHSYLLSVKASEEEARDSLLYSYKHSINGF 73 >ref|XP_002269375.1| PREDICTED: subtilisin-like protease-like [Vitis vinifera] Length = 778 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -1 Query: 175 AYSAQTKVYTVYLGNHSGEKTLHEIEESHHSYLFSVKKTEEEARTSLLYSYKNIFNGF 2 A A+ KVY VY G HSG+K LHEIE+ HHSYL SVK +EEEAR SLLYSYK+ NGF Sbjct: 16 ASCAERKVYIVYFGGHSGQKALHEIEDYHHSYLLSVKASEEEARDSLLYSYKHSINGF 73 >emb|CAN61728.1| hypothetical protein VITISV_036029 [Vitis vinifera] Length = 860 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/58 (68%), Positives = 45/58 (77%) Frame = -1 Query: 175 AYSAQTKVYTVYLGNHSGEKTLHEIEESHHSYLFSVKKTEEEARTSLLYSYKNIFNGF 2 A A+ KVY VY G HSG+K LHEIE+ HHSYL SVK +EEEAR SLLYSYK+ NGF Sbjct: 16 ASCAERKVYIVYFGEHSGQKALHEIEDYHHSYLLSVKASEEEARDSLLYSYKHSINGF 73