BLASTX nr result
ID: Bupleurum21_contig00037151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037151 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510551.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_002887612.1| hypothetical protein ARALYDRAFT_476728 [Arab... 55 5e-06 ref|NP_565118.1| uncharacterized protein [Arabidopsis thaliana] ... 55 5e-06 >ref|XP_002510551.1| conserved hypothetical protein [Ricinus communis] gi|223551252|gb|EEF52738.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -2 Query: 330 HHVCRGGICWHGVAVKSPASQLRLRFLQHDQTY 232 H +C+GGICWHGVAV+SPASQ+R R QH Q + Sbjct: 75 HEMCKGGICWHGVAVRSPASQVRFRLPQHHQPH 107 >ref|XP_002887612.1| hypothetical protein ARALYDRAFT_476728 [Arabidopsis lyrata subsp. lyrata] gi|297333453|gb|EFH63871.1| hypothetical protein ARALYDRAFT_476728 [Arabidopsis lyrata subsp. lyrata] Length = 122 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/34 (67%), Positives = 27/34 (79%), Gaps = 4/34 (11%) Frame = -2 Query: 333 HHH----VCRGGICWHGVAVKSPASQLRLRFLQH 244 HHH +C+GGICWHGVAV+SPASQ+R R QH Sbjct: 83 HHHDGGAICKGGICWHGVAVRSPASQVRFRLPQH 116 >ref|NP_565118.1| uncharacterized protein [Arabidopsis thaliana] gi|6721099|gb|AAF26753.1|AC007396_2 T4O12.4 [Arabidopsis thaliana] gi|37202064|gb|AAQ89647.1| At1g75810 [Arabidopsis thaliana] gi|51971341|dbj|BAD44335.1| hypothetical protein [Arabidopsis thaliana] gi|332197640|gb|AEE35761.1| uncharacterized protein [Arabidopsis thaliana] Length = 125 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/34 (67%), Positives = 27/34 (79%), Gaps = 4/34 (11%) Frame = -2 Query: 333 HHH----VCRGGICWHGVAVKSPASQLRLRFLQH 244 HHH +C+GGICWHGVAV+SPASQ+R R QH Sbjct: 86 HHHDGGAICKGGICWHGVAVRSPASQVRFRLPQH 119