BLASTX nr result
ID: Bupleurum21_contig00037075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037075 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537360.1| PREDICTED: uncharacterized protein LOC100786... 68 7e-10 ref|XP_003611801.1| Upstream activation factor subunit spp27 [Me... 67 1e-09 ref|XP_003517283.1| PREDICTED: upstream activation factor subuni... 67 2e-09 ref|XP_003517282.1| PREDICTED: upstream activation factor subuni... 67 2e-09 tpg|DAA51566.1| TPA: hypothetical protein ZEAMMB73_058775 [Zea m... 64 2e-08 >ref|XP_003537360.1| PREDICTED: uncharacterized protein LOC100786835 [Glycine max] Length = 346 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +2 Query: 95 IEDPSDKKKVLCDSKLKELFGVDTCIGFTLTKLLTPHFIK 214 ++DPSDK+K++CD KLKELF VDT GFT+TKLL PHFIK Sbjct: 304 LQDPSDKRKIICDEKLKELFDVDTFTGFTVTKLLAPHFIK 343 >ref|XP_003611801.1| Upstream activation factor subunit spp27 [Medicago truncatula] gi|355513136|gb|AES94759.1| Upstream activation factor subunit spp27 [Medicago truncatula] Length = 361 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = +2 Query: 95 IEDPSDKKKVLCDSKLKELFGVDTCIGFTLTKLLTPHFIK 214 ++DPSDK+++LCD KLKELF VD+ +GFT+TKLL PHFIK Sbjct: 302 LQDPSDKRQILCDEKLKELFDVDSFVGFTVTKLLAPHFIK 341 >ref|XP_003517283.1| PREDICTED: upstream activation factor subunit spp27-like isoform 2 [Glycine max] Length = 331 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 95 IEDPSDKKKVLCDSKLKELFGVDTCIGFTLTKLLTPHFIK 214 ++DPSDK+K++CD KLKELF VD+ GFT+TKLL PHFIK Sbjct: 289 LQDPSDKRKIICDEKLKELFDVDSFTGFTVTKLLAPHFIK 328 >ref|XP_003517282.1| PREDICTED: upstream activation factor subunit spp27-like isoform 1 [Glycine max] Length = 337 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = +2 Query: 95 IEDPSDKKKVLCDSKLKELFGVDTCIGFTLTKLLTPHFIK 214 ++DPSDK+K++CD KLKELF VD+ GFT+TKLL PHFIK Sbjct: 295 LQDPSDKRKIICDEKLKELFDVDSFTGFTVTKLLAPHFIK 334 >tpg|DAA51566.1| TPA: hypothetical protein ZEAMMB73_058775 [Zea mays] Length = 61 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +2 Query: 95 IEDPSDKKKVLCDSKLKELFGVDTCIGFTLTKLLTPHFIK 214 ++DPSD++K++CD KLK+LFGV+T GFT++KLL PHF K Sbjct: 20 LQDPSDRRKIICDEKLKDLFGVETFTGFTVSKLLAPHFTK 59