BLASTX nr result
ID: Bupleurum21_contig00037027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037027 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACG29148.1| hypothetical protein [Zea mays] 56 3e-06 ref|XP_002443905.1| hypothetical protein SORBIDRAFT_07g004115 [S... 55 8e-06 >gb|ACG29148.1| hypothetical protein [Zea mays] Length = 560 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = +3 Query: 57 NELWDFIIKHWEDPSFIKRSQQASEARKKLKNPHTSGATSFVRRSEIL-TRKLGHEPSKF 233 NE W+ ++++W+ P ++ SQ+ + R K+K T+G+ S++ EIL + +G EP Sbjct: 355 NEEWNDLVEYWKSPKRMETSQKNKDNRSKVKFHQTTGSRSYMVHVEILGDKNIGQEPDAL 414 Query: 234 TLYKETHTSKKTGEYSS 284 L+KE H S+K Y+S Sbjct: 415 DLFKECHYSRKKKCYTS 431 >ref|XP_002443905.1| hypothetical protein SORBIDRAFT_07g004115 [Sorghum bicolor] gi|241940255|gb|EES13400.1| hypothetical protein SORBIDRAFT_07g004115 [Sorghum bicolor] Length = 565 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/66 (39%), Positives = 35/66 (53%) Frame = +3 Query: 66 WDFIIKHWEDPSFIKRSQQASEARKKLKNPHTSGATSFVRRSEILTRKLGHEPSKFTLYK 245 W F+IKHW P F R + + R KL+ HTSG+ SF + +LG P + +Y Sbjct: 235 WKFLIKHWTSPEFEARMEISKANRTKLRIHHTSGSKSFACSRHEMAIELGRVPRRDEIYI 294 Query: 246 ETHTSK 263 THT K Sbjct: 295 RTHTRK 300