BLASTX nr result
ID: Bupleurum21_contig00037009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037009 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003608721.1| Vesicle-associated membrane protein-associat... 55 5e-06 >ref|XP_003608721.1| Vesicle-associated membrane protein-associated protein [Medicago truncatula] gi|355509776|gb|AES90918.1| Vesicle-associated membrane protein-associated protein [Medicago truncatula] gi|388505190|gb|AFK40661.1| unknown [Medicago truncatula] Length = 242 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +3 Query: 210 PPNELFSVEPLRLKFSAEMDS-ISCSLFQLSNKSDKHVSFRVKTTNP 347 P +L S+EPL LKF E+ ISCSL QLSNK+D +V+F+VKTTNP Sbjct: 3 PDGDLLSIEPLELKFPFELKKQISCSL-QLSNKTDSYVAFKVKTTNP 48