BLASTX nr result
ID: Bupleurum21_contig00036993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036993 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17585.3| unnamed protein product [Vitis vinifera] 104 8e-21 ref|XP_002269506.1| PREDICTED: pentatricopeptide repeat-containi... 104 8e-21 ref|XP_002533281.1| pentatricopeptide repeat-containing protein,... 81 1e-13 ref|XP_003538834.1| PREDICTED: pentatricopeptide repeat-containi... 73 2e-11 ref|XP_003611888.1| Pentatricopeptide repeat-containing protein ... 73 3e-11 >emb|CBI17585.3| unnamed protein product [Vitis vinifera] Length = 636 Score = 104 bits (259), Expect = 8e-21 Identities = 50/89 (56%), Positives = 68/89 (76%) Frame = -3 Query: 269 VHISRIFHRQVLFDTFTIQSRYFSRNPSINQVSLYLQRAKLIDSIRLTMRSNSPESLVST 90 +++ ++F + LF+ Q+RYF+ NP ++SLYL RA+LIDSIRL +RSN+P SL+ Sbjct: 1 MYVKQLFRKLCLFNNPMQQTRYFTHNPFSGKISLYLHRARLIDSIRLILRSNAPRSLIPL 60 Query: 89 LNDPALDSFVVTNALHSAPSPESALVLVE 3 LNDP +DSFVV NAL SAPSP+SAL L+E Sbjct: 61 LNDPTVDSFVVANALQSAPSPDSALSLLE 89 >ref|XP_002269506.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like [Vitis vinifera] Length = 660 Score = 104 bits (259), Expect = 8e-21 Identities = 50/89 (56%), Positives = 68/89 (76%) Frame = -3 Query: 269 VHISRIFHRQVLFDTFTIQSRYFSRNPSINQVSLYLQRAKLIDSIRLTMRSNSPESLVST 90 +++ ++F + LF+ Q+RYF+ NP ++SLYL RA+LIDSIRL +RSN+P SL+ Sbjct: 1 MYVKQLFRKLCLFNNPMQQTRYFTHNPFSGKISLYLHRARLIDSIRLILRSNAPRSLIPL 60 Query: 89 LNDPALDSFVVTNALHSAPSPESALVLVE 3 LNDP +DSFVV NAL SAPSP+SAL L+E Sbjct: 61 LNDPTVDSFVVANALQSAPSPDSALSLLE 89 >ref|XP_002533281.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526906|gb|EEF29113.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 652 Score = 80.9 bits (198), Expect = 1e-13 Identities = 44/89 (49%), Positives = 63/89 (70%), Gaps = 1/89 (1%) Frame = -3 Query: 266 HISRIFHRQVLFDTFTIQSRYFSRNPSINQVSLYLQRAKLIDSIRLTMRSNSPESLVSTL 87 H SR ++ F+ T Q R+F R+P N+++ YL+RA+LIDSIRL +RSNSP S+ + L Sbjct: 5 HFSRTINK---FNILTQQIRFFVRDPFPNKLTHYLRRAELIDSIRLALRSNSPNSITTFL 61 Query: 86 NDP-ALDSFVVTNALHSAPSPESALVLVE 3 N+ LD FV+T+ + SAPS +SAL L+E Sbjct: 62 NNTRILDPFVITHTIRSAPSADSALFLIE 90 >ref|XP_003538834.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like [Glycine max] Length = 658 Score = 73.2 bits (178), Expect = 2e-11 Identities = 46/93 (49%), Positives = 60/93 (64%), Gaps = 5/93 (5%) Frame = -3 Query: 269 VHISRIFHRQVLFDTFT--IQSRYFSRN--PSINQVSLYLQRAKLIDSIRLTMRSNSPE- 105 +H+ F L + T +Q+R ++R P +VS YL RAKLIDSIRLT+RSN+P Sbjct: 3 MHLRPFFREANLLNGLTSRVQARSYARRREPFPTKVSHYLHRAKLIDSIRLTLRSNTPNP 62 Query: 104 SLVSTLNDPALDSFVVTNALHSAPSPESALVLV 6 SL S +N +DSFV T+AL SAPS +SAL V Sbjct: 63 SLPSLINHRLMDSFVATHALRSAPSADSALSFV 95 >ref|XP_003611888.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513223|gb|AES94846.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 659 Score = 72.8 bits (177), Expect = 3e-11 Identities = 41/76 (53%), Positives = 56/76 (73%), Gaps = 3/76 (3%) Frame = -3 Query: 224 FTIQSRYFSR--NPSINQVSLYLQRAKLIDSIRLTMRSNSPESLVSTL-NDPALDSFVVT 54 F IQ R+++R +P +++ YL RAKLIDSIRL++RSN+P S +STL N DSFV+T Sbjct: 17 FRIQIRFYTRRRDPFPTKITHYLNRAKLIDSIRLSLRSNNPNSTLSTLINHRLFDSFVLT 76 Query: 53 NALHSAPSPESALVLV 6 +AL SAP +SAL L+ Sbjct: 77 HALRSAPCADSALSLI 92