BLASTX nr result
ID: Bupleurum21_contig00036940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036940 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634534.1| PREDICTED: leucine-rich repeat receptor-like... 64 2e-08 ref|XP_002327333.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002325559.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_003634534.1| PREDICTED: leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820-like [Vitis vinifera] Length = 946 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -1 Query: 136 ISRRYYSVKNVHSNSVEDVPQPQVIKGKMLTANAIHRSNIDFTSA 2 ISRR+Y VK+ + ED+P PQV++G +LTANAIHRSNIDFT A Sbjct: 621 ISRRFYRVKDEPLGATEDLPPPQVVQGNLLTANAIHRSNIDFTKA 665 >ref|XP_002327333.1| predicted protein [Populus trichocarpa] gi|222835703|gb|EEE74138.1| predicted protein [Populus trichocarpa] Length = 948 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -1 Query: 136 ISRRYYSVKNVHSNSVEDVPQPQVIKGKMLTANAIHRSNIDFT 8 +SRR+ V N S S E++P PQVI+G +LT N IHRSNIDFT Sbjct: 623 LSRRFLKVNNQQSQSGEELPPPQVIEGILLTTNGIHRSNIDFT 665 >ref|XP_002325559.1| predicted protein [Populus trichocarpa] gi|222862434|gb|EEE99940.1| predicted protein [Populus trichocarpa] Length = 947 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 133 SRRYYSVKNVHSNSVEDVPQPQVIKGKMLTANAIHRSNIDFTSA 2 SRR+ V + S S E++P PQVI+G +LT N IHRS+IDFT+A Sbjct: 623 SRRFLKVNDQQSQSGENLPSPQVIQGNLLTTNGIHRSSIDFTNA 666