BLASTX nr result
ID: Bupleurum21_contig00036891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036891 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520543.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_002314165.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_002299860.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_003543519.1| PREDICTED: uncharacterized protein LOC100790... 56 3e-06 gb|AEB71567.1| RTL5-like protein [Solanum chacoense] 56 3e-06 >ref|XP_002520543.1| conserved hypothetical protein [Ricinus communis] gi|223540385|gb|EEF41956.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 153 RKCGSLAKEQKAKFYIVKRCITMLVFWNKHSDS 251 RKC SLAKEQKA+FYI++RC+ MLV W+KH DS Sbjct: 71 RKCSSLAKEQKARFYIMRRCVAMLVCWHKHGDS 103 >ref|XP_002314165.1| predicted protein [Populus trichocarpa] gi|222850573|gb|EEE88120.1| predicted protein [Populus trichocarpa] Length = 91 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 153 RKCGSLAKEQKAKFYIVKRCITMLVFWNKHSDS 251 RKC SLAKEQKA+FYI++RC+ MLV W+KH DS Sbjct: 59 RKCSSLAKEQKARFYIMRRCVAMLVCWHKHGDS 91 >ref|XP_002299860.1| predicted protein [Populus trichocarpa] gi|222847118|gb|EEE84665.1| predicted protein [Populus trichocarpa] Length = 91 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 156 KCGSLAKEQKAKFYIVKRCITMLVFWNKHSDS 251 KC SLAKEQKA+FYI++RC+ MLV W+KH DS Sbjct: 60 KCSSLAKEQKARFYIMRRCVAMLVCWHKHGDS 91 >ref|XP_003543519.1| PREDICTED: uncharacterized protein LOC100790962 [Glycine max] Length = 98 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +3 Query: 153 RKCGSLAKEQKAKFYIVKRCITMLVFWNKHSDS 251 RKC LAKEQKA+FYI++RC+ MLV W+KH DS Sbjct: 66 RKCTKLAKEQKARFYIMRRCVAMLVCWHKHGDS 98 >gb|AEB71567.1| RTL5-like protein [Solanum chacoense] Length = 109 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +3 Query: 156 KCGSLAKEQKAKFYIVKRCITMLVFWNKH 242 KC ++AKEQKAKFYIVKRCI MLV WNKH Sbjct: 75 KCSTMAKEQKAKFYIVKRCIAMLVRWNKH 103