BLASTX nr result
ID: Bupleurum21_contig00036773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036773 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535305.1| conserved hypothetical protein [Ricinus comm... 104 1e-24 ref|XP_002334101.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002535305.1| conserved hypothetical protein [Ricinus communis] gi|223523491|gb|EEF27078.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 104 bits (259), Expect(2) = 1e-24 Identities = 50/54 (92%), Positives = 50/54 (92%) Frame = -1 Query: 197 GKKGPKHGRCRTLERQRKARPYLFFQACSDIRFPRKIKLVSRVMGNLPARFGEH 36 GKKGPKH RCRTLE QRKA YLFFQACSDIRFPRKIKLVSRVMGNLPARFGEH Sbjct: 130 GKKGPKHLRCRTLEWQRKAGSYLFFQACSDIRFPRKIKLVSRVMGNLPARFGEH 183 Score = 33.5 bits (75), Expect(2) = 1e-24 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 252 QACTPYLRLLRQAVDSFIRE 193 QACT LRLLRQAVDSFIRE Sbjct: 112 QACT--LRLLRQAVDSFIRE 129 >ref|XP_002334101.1| predicted protein [Populus trichocarpa] gi|222869592|gb|EEF06723.1| predicted protein [Populus trichocarpa] Length = 69 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 24 HSNSVLSEPCGKVSHHTAHQLDLPR 98 HSNSVLSEPCGKVSHHTAH+LDLPR Sbjct: 14 HSNSVLSEPCGKVSHHTAHRLDLPR 38