BLASTX nr result
ID: Bupleurum21_contig00036730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036730 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142520.1| PREDICTED: pentatricopeptide repeat-containi... 161 6e-38 ref|XP_002268375.1| PREDICTED: pentatricopeptide repeat-containi... 143 2e-32 emb|CAN80394.1| hypothetical protein VITISV_001596 [Vitis vinifera] 141 6e-32 ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containi... 126 2e-27 ref|XP_002522032.1| pentatricopeptide repeat-containing protein,... 116 2e-24 >ref|XP_004142520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Cucumis sativus] gi|449518358|ref|XP_004166209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Cucumis sativus] Length = 455 Score = 161 bits (407), Expect = 6e-38 Identities = 78/114 (68%), Positives = 91/114 (79%) Frame = +3 Query: 3 YFATVHHISNIVRRDIYMERTLNKMGLSRIVNSELVYRVLRNCCNSGSQSFRFFNWVRTQ 182 YFA +HHIS+IVRRD YMERTLNK+ +S + NSELV+RVLR C NSG++SFRFFNW + Sbjct: 41 YFAAIHHISHIVRRDFYMERTLNKLRISNL-NSELVFRVLRACSNSGTESFRFFNWACSH 99 Query: 183 HPQYDPTTLEFEELLKNLARTRCWETMWKVAHQMKAQELPISPSVISFIIEHYG 344 +P Y PTTLEFEEL+K LARTR + TMWKV QMK Q L ISP ISFII+ YG Sbjct: 100 NPSYQPTTLEFEELVKTLARTRKYTTMWKVLLQMKTQNLKISPETISFIIQEYG 153 >ref|XP_002268375.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Vitis vinifera] gi|296085168|emb|CBI28663.3| unnamed protein product [Vitis vinifera] Length = 454 Score = 143 bits (360), Expect = 2e-32 Identities = 72/114 (63%), Positives = 90/114 (78%) Frame = +3 Query: 3 YFATVHHISNIVRRDIYMERTLNKMGLSRIVNSELVYRVLRNCCNSGSQSFRFFNWVRTQ 182 YFA VHHIS IVRRD Y+ERTLNK+ +S V S+LVYRVLR+C NSG++S RFFNW R+ Sbjct: 46 YFAVVHHISAIVRRDFYLERTLNKLPIS--VTSDLVYRVLRSCPNSGTESLRFFNWARS- 102 Query: 183 HPQYDPTTLEFEELLKNLARTRCWETMWKVAHQMKAQELPISPSVISFIIEHYG 344 H Y PTTLE+EELLK LART+ ++ MWK+AHQM+ +SP+V+S IIE +G Sbjct: 103 HLSYQPTTLEYEELLKTLARTKQFQPMWKIAHQMQT----LSPTVVSSIIEEFG 152 >emb|CAN80394.1| hypothetical protein VITISV_001596 [Vitis vinifera] Length = 356 Score = 141 bits (355), Expect = 6e-32 Identities = 71/113 (62%), Positives = 89/113 (78%) Frame = +3 Query: 6 FATVHHISNIVRRDIYMERTLNKMGLSRIVNSELVYRVLRNCCNSGSQSFRFFNWVRTQH 185 FA VHHIS IVRRD Y+ERTLNK+ +S V S+LVYRVLR+C NSG++S RFFNW R+ H Sbjct: 4 FAVVHHISAIVRRDFYLERTLNKLPIS--VTSDLVYRVLRSCPNSGTESLRFFNWARS-H 60 Query: 186 PQYDPTTLEFEELLKNLARTRCWETMWKVAHQMKAQELPISPSVISFIIEHYG 344 Y PTTLE+EELLK LART+ ++ MWK+AHQM+ +SP+V+S IIE +G Sbjct: 61 XSYQPTTLEYEELLKTLARTKQFQPMWKIAHQMQT----LSPTVVSSIIEEFG 109 >ref|XP_003524064.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Glycine max] Length = 450 Score = 126 bits (317), Expect = 2e-27 Identities = 60/115 (52%), Positives = 83/115 (72%), Gaps = 1/115 (0%) Frame = +3 Query: 3 YFATVHHISNIVRRDIYMERTLNKMGLSRIVNSELVYRVLRNCCNSGSQSFRFFNWVRTQ 182 YFA +HH+SNIVRRD Y+ERTLNK+ ++ V ELV+RVLR C N+ ++S RFFNW RT Sbjct: 38 YFAVIHHVSNIVRRDFYLERTLNKLRIT--VTPELVFRVLRACSNNPTESLRFFNWART- 94 Query: 183 HPQYDPTTLEFEELLKNLARTRCWETMWKVAHQMKA-QELPISPSVISFIIEHYG 344 HP Y PT+LEFE+++ LAR +++MW + Q+ L +SPS ++ +IE YG Sbjct: 95 HPSYSPTSLEFEQIVTTLARANTYQSMWALIRQVTLHHRLSLSPSAVASVIEAYG 149 >ref|XP_002522032.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538836|gb|EEF40436.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 451 Score = 116 bits (290), Expect = 2e-24 Identities = 62/116 (53%), Positives = 80/116 (68%), Gaps = 2/116 (1%) Frame = +3 Query: 3 YFATVHHISNIVRRDIYMERTLNKMGLSRIVNSELVYRVLRNCCNSGSQSFRFFNWVRTQ 182 YFA +HHI+NIVRRD Y ERTLNK L+ V SELV+RVLR C S ++S RFFNW R Sbjct: 40 YFALIHHITNIVRRDFYPERTLNK--LNAPVTSELVFRVLRACSRSPTESLRFFNWSRA- 96 Query: 183 HPQYDPTTLEFEELLKNLARTRCWETMWKVAHQMKAQ--ELPISPSVISFIIEHYG 344 Y PT++E+EEL+K LA+++ + +MWK+ QMK Q + IS + IIE YG Sbjct: 97 --YYTPTSIEYEELIKILAKSKRYSSMWKLITQMKDQNPQFSISSETVRSIIEEYG 150