BLASTX nr result
ID: Bupleurum21_contig00036666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036666 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518269.1| PREDICTED: uncharacterized protein LOC100777... 76 3e-12 >ref|XP_003518269.1| PREDICTED: uncharacterized protein LOC100777373 [Glycine max] Length = 3038 Score = 76.3 bits (186), Expect = 3e-12 Identities = 39/63 (61%), Positives = 44/63 (69%), Gaps = 6/63 (9%) Frame = -3 Query: 173 YPASPWQ------PRPTPQSRQPGVLGSKPQAYNAAVTPSSVGYTPTDIEAAMHALSFSQ 12 YPAS W P P+ +PG+LG +PQAYNA P+S YTPTDIEAAMHALSFSQ Sbjct: 274 YPASSWALKNVVTPTVGPRQSRPGILGLRPQAYNAIAPPTS--YTPTDIEAAMHALSFSQ 331 Query: 11 PDG 3 PDG Sbjct: 332 PDG 334