BLASTX nr result
ID: Bupleurum21_contig00036576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036576 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002437934.1| hypothetical protein SORBIDRAFT_10g005066 [S... 54 1e-05 >ref|XP_002437934.1| hypothetical protein SORBIDRAFT_10g005066 [Sorghum bicolor] gi|241916157|gb|EER89301.1| hypothetical protein SORBIDRAFT_10g005066 [Sorghum bicolor] Length = 553 Score = 54.3 bits (129), Expect = 1e-05 Identities = 34/122 (27%), Positives = 61/122 (50%) Frame = -2 Query: 377 LPSSLSEIDFSFIHDEFMIPSSFNLIMPEPHHKIYSPLIVGEDKAIGITRAAFQCGLRLP 198 + SSL++ + I ++ +P ++ ++P H + SPL G AI + A + G+R+P Sbjct: 41 IASSLTQEELDAICSKYGVPEQYSAVLPAGHQRACSPLPPG---AICVNEHALEAGMRVP 97 Query: 197 LHPFVKHILRETEVGLGQLMPNSFFHINSFIARSRERSINLNPFLFWRHFHIVIAPKCPG 18 LH F +L V Q+ PN + + FI S + + + +F RHF + + G Sbjct: 98 LHAFFCEVLAHFGVAPIQIAPNGWRAMAGFIVLSHKAGVAPSLPVF-RHFFSLCGFRFKG 156 Query: 17 FY 12 +Y Sbjct: 157 WY 158