BLASTX nr result
ID: Bupleurum21_contig00036528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036528 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281058.1| PREDICTED: pentatricopeptide repeat-containi... 172 3e-41 emb|CBI16134.3| unnamed protein product [Vitis vinifera] 166 2e-39 ref|XP_004143204.1| PREDICTED: pentatricopeptide repeat-containi... 163 2e-38 ref|XP_002532856.1| pentatricopeptide repeat-containing protein,... 157 6e-37 ref|XP_003547021.1| PREDICTED: pentatricopeptide repeat-containi... 157 8e-37 >ref|XP_002281058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07590, mitochondrial [Vitis vinifera] Length = 550 Score = 172 bits (436), Expect = 3e-41 Identities = 85/107 (79%), Positives = 96/107 (89%) Frame = +2 Query: 5 LKDGLVKYALRTLVLGMGHATSTKIRKSTPWLETTHSMVEIFAEKGDVENAEKLFEELKK 184 LK GL++ AL+TL LG G ST+IRKS PWLETT S+VEIF+E GDVENAEKLFEELK Sbjct: 437 LKAGLLEEALKTLELGKGLTISTRIRKSIPWLETTLSIVEIFSENGDVENAEKLFEELKT 496 Query: 185 ANYTKYTFVYNTLIRAYVKAKIYDPNLLRRMILGGARPDSETYSLLK 325 ANYT+YTFVYNTLI+AYVKAK+YDPNLLRRMILGGARPD+ETYSL+K Sbjct: 497 ANYTRYTFVYNTLIKAYVKAKVYDPNLLRRMILGGARPDAETYSLMK 543 >emb|CBI16134.3| unnamed protein product [Vitis vinifera] Length = 453 Score = 166 bits (419), Expect = 2e-39 Identities = 81/99 (81%), Positives = 90/99 (90%) Frame = +2 Query: 29 ALRTLVLGMGHATSTKIRKSTPWLETTHSMVEIFAEKGDVENAEKLFEELKKANYTKYTF 208 AL+TL LG G ST+IRKS PWLETT S+VEIF+E GDVENAEKLFEELK ANYT+YTF Sbjct: 348 ALKTLELGKGLTISTRIRKSIPWLETTLSIVEIFSENGDVENAEKLFEELKTANYTRYTF 407 Query: 209 VYNTLIRAYVKAKIYDPNLLRRMILGGARPDSETYSLLK 325 VYNTLI+AYVKAK+YDPNLLRRMILGGARPD+ETYSL+K Sbjct: 408 VYNTLIKAYVKAKVYDPNLLRRMILGGARPDAETYSLMK 446 >ref|XP_004143204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07590, mitochondrial-like [Cucumis sativus] gi|449517541|ref|XP_004165804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07590, mitochondrial-like [Cucumis sativus] Length = 527 Score = 163 bits (412), Expect = 2e-38 Identities = 82/108 (75%), Positives = 96/108 (88%), Gaps = 1/108 (0%) Frame = +2 Query: 5 LKDGLVKYALRTLVLGMGHATSTKI-RKSTPWLETTHSMVEIFAEKGDVENAEKLFEELK 181 LK GLV+ AL+TL LG +STKI RKSTPWLETT SM+EI AE+GD+EN EKLF+ELK Sbjct: 413 LKAGLVEEALKTLDLGSNTTSSTKIVRKSTPWLETTLSMIEILAERGDIENTEKLFKELK 472 Query: 182 KANYTKYTFVYNTLIRAYVKAKIYDPNLLRRMILGGARPDSETYSLLK 325 +A YT+YTFVYNTLI+AYVKAKI++PNLLRRMI+GGARPDSETYSL+K Sbjct: 473 EAKYTRYTFVYNTLIKAYVKAKIHNPNLLRRMIVGGARPDSETYSLIK 520 >ref|XP_002532856.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527393|gb|EEF29534.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 521 Score = 157 bits (398), Expect = 6e-37 Identities = 79/107 (73%), Positives = 89/107 (83%) Frame = +2 Query: 5 LKDGLVKYALRTLVLGMGHATSTKIRKSTPWLETTHSMVEIFAEKGDVENAEKLFEELKK 184 LK LV+ AL+TL +GM TS KI+ S PWLETT S+VEIFAEKGDV NAEK FEEL K Sbjct: 408 LKAELVEEALKTLEMGMDFTTSNKIKNSIPWLETTFSIVEIFAEKGDVANAEKFFEELHK 467 Query: 185 ANYTKYTFVYNTLIRAYVKAKIYDPNLLRRMILGGARPDSETYSLLK 325 A Y +YTFVYNTLI+AYVKAK+Y P LLRRMILGGARPD+ETYSL+K Sbjct: 468 AKYARYTFVYNTLIKAYVKAKVYVPYLLRRMILGGARPDAETYSLIK 514 >ref|XP_003547021.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07590, mitochondrial-like [Glycine max] Length = 507 Score = 157 bits (397), Expect = 8e-37 Identities = 77/107 (71%), Positives = 90/107 (84%) Frame = +2 Query: 5 LKDGLVKYALRTLVLGMGHATSTKIRKSTPWLETTHSMVEIFAEKGDVENAEKLFEELKK 184 LK G+ + AL+TL LG+ S ++R STPWLETT S+VEIFAEKGDV N E+LFEE K Sbjct: 394 LKSGMAEQALKTLDLGLRLTISKRVRNSTPWLETTLSIVEIFAEKGDVGNVERLFEEFHK 453 Query: 185 ANYTKYTFVYNTLIRAYVKAKIYDPNLLRRMILGGARPDSETYSLLK 325 A Y +YTFVYNTLI+AYVKAKIY+PNLL+RMILGGARPD+ETYSLLK Sbjct: 454 AKYCRYTFVYNTLIKAYVKAKIYNPNLLKRMILGGARPDAETYSLLK 500