BLASTX nr result
ID: Bupleurum21_contig00035723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00035723 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002979302.1| hypothetical protein SELMODRAFT_110606 [Sela... 55 6e-06 ref|XP_002988611.1| hypothetical protein SELMODRAFT_128208 [Sela... 55 6e-06 >ref|XP_002979302.1| hypothetical protein SELMODRAFT_110606 [Selaginella moellendorffii] gi|300153070|gb|EFJ19710.1| hypothetical protein SELMODRAFT_110606 [Selaginella moellendorffii] Length = 513 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 38 LQSLRSFDPSGIAIDLLLKLLEYDPIKRITAADALKHEYF 157 L ++ + P G+A DLL ++LEYDP+KRITAA AL HEYF Sbjct: 289 LHTVVNLQPKGLAFDLLSRMLEYDPVKRITAAQALDHEYF 328 >ref|XP_002988611.1| hypothetical protein SELMODRAFT_128208 [Selaginella moellendorffii] gi|300143718|gb|EFJ10407.1| hypothetical protein SELMODRAFT_128208 [Selaginella moellendorffii] Length = 511 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 38 LQSLRSFDPSGIAIDLLLKLLEYDPIKRITAADALKHEYF 157 L ++ + P G+A DLL ++LEYDP+KRITAA AL HEYF Sbjct: 289 LHTVVNLQPKGLAFDLLSRMLEYDPVKRITAAQALDHEYF 328