BLASTX nr result
ID: Bupleurum21_contig00035605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00035605 (554 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527379.1| carbohydrate transporter, putative [Ricinus ... 62 6e-08 >ref|XP_002527379.1| carbohydrate transporter, putative [Ricinus communis] gi|223533250|gb|EEF35004.1| carbohydrate transporter, putative [Ricinus communis] Length = 500 Score = 62.0 bits (149), Expect = 6e-08 Identities = 24/61 (39%), Positives = 35/61 (57%) Frame = +2 Query: 116 MEIEGKDEEKIRMVAKSSNIKNQDGGYYEKCPGCEIDKLKHSNPLIPFKHLIFVFVITLC 295 M + +E+ R + G YYE CPGC++D K +NP IP KHL +V+++ LC Sbjct: 1 MAVADHEEKNYRQTLLDKTNSSSSGRYYENCPGCQLDLFKQTNPAIPVKHLFYVWIVVLC 60 Query: 296 A 298 A Sbjct: 61 A 61