BLASTX nr result
ID: Bupleurum21_contig00035550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00035550 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24668.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002273791.1| PREDICTED: uncharacterized protein C3B8.09-l... 66 3e-09 gb|AFK43843.1| unknown [Medicago truncatula] 59 4e-07 ref|XP_003608060.1| Something about silencing protein [Medicago ... 59 4e-07 gb|ABI34329.1| Integrase core domain containing protein [Solanum... 59 5e-07 >emb|CBI24668.3| unnamed protein product [Vitis vinifera] Length = 719 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 267 PEILFDGKRHITQQMEKNRGLTRARKKLSKNPRKKYK 157 PEIL DGKR I+ QMEKN+GLTRARKKL+KNPRKKYK Sbjct: 640 PEILEDGKRQISYQMEKNKGLTRARKKLTKNPRKKYK 676 >ref|XP_002273791.1| PREDICTED: uncharacterized protein C3B8.09-like [Vitis vinifera] Length = 669 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 267 PEILFDGKRHITQQMEKNRGLTRARKKLSKNPRKKYK 157 PEIL DGKR I+ QMEKN+GLTRARKKL+KNPRKKYK Sbjct: 590 PEILEDGKRQISYQMEKNKGLTRARKKLTKNPRKKYK 626 >gb|AFK43843.1| unknown [Medicago truncatula] Length = 152 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 276 PVLPEILFDGKRHITQQMEKNRGLTRARKKLSKNPRKKYK 157 P LPE DGKR+IT QM KNRGLTR+R K KNPRK YK Sbjct: 70 PSLPEETADGKRYITSQMSKNRGLTRSRNKDKKNPRKNYK 109 >ref|XP_003608060.1| Something about silencing protein [Medicago truncatula] gi|355509115|gb|AES90257.1| Something about silencing protein [Medicago truncatula] Length = 653 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 276 PVLPEILFDGKRHITQQMEKNRGLTRARKKLSKNPRKKYK 157 P LPE DGKR+IT QM KNRGLTR+R K KNPRK YK Sbjct: 571 PSLPEETADGKRYITSQMSKNRGLTRSRNKDKKNPRKNYK 610 >gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -3 Query: 267 PEILFDGKRHITQQMEKNRGLTRARKKLSKNPRKKYK 157 PE + DGKR I QMEKNRGLTR RKK KNPRKKY+ Sbjct: 1696 PETVVDGKRQINYQMEKNRGLTRNRKKQDKNPRKKYR 1732