BLASTX nr result
ID: Bupleurum21_contig00035542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00035542 (512 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77149.1| hypothetical protein VITISV_019364 [Vitis vinifera] 67 1e-09 emb|CAN65627.1| hypothetical protein VITISV_032735 [Vitis vinifera] 67 2e-09 gb|ABI34377.1| Polyprotein, putative [Solanum demissum] 64 1e-08 >emb|CAN77149.1| hypothetical protein VITISV_019364 [Vitis vinifera] Length = 1544 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 177 RKMTFNPLATILKENKLTGDNYIDWKRNLDIVLTAEEYKFCVTE 46 R +FNPLA IL + KL G NY+DWKRNLDI+LTAEEYKF ++E Sbjct: 321 RMTSFNPLANILTQXKLEGPNYVDWKRNLDILLTAEEYKFVLSE 364 >emb|CAN65627.1| hypothetical protein VITISV_032735 [Vitis vinifera] Length = 1285 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 168 TFNPLATILKENKLTGDNYIDWKRNLDIVLTAEEYKFCVTE 46 +FNPLA IL +NKL G NY+DWKRNLDI+ TAEEYKF ++E Sbjct: 3 SFNPLANILTQNKLEGPNYVDWKRNLDILQTAEEYKFVLSE 43 >gb|ABI34377.1| Polyprotein, putative [Solanum demissum] Length = 233 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 165 FNPLATILKENKLTGDNYIDWKRNLDIVLTAEEYKFCVTE 46 FNP++TIL +NKL G NY+DW+R LDIVLTAEEYKF + E Sbjct: 4 FNPISTILDQNKLEGSNYVDWRRILDIVLTAEEYKFVLHE 43