BLASTX nr result
ID: Bupleurum21_contig00033851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033851 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317294.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002519637.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 ref|XP_003607806.1| hypothetical protein MTR_4g083110 [Medicago ... 62 4e-08 ref|XP_002305342.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-... 61 8e-08 >ref|XP_002317294.1| predicted protein [Populus trichocarpa] gi|222860359|gb|EEE97906.1| predicted protein [Populus trichocarpa] Length = 84 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -1 Query: 348 RIARFVTEVAPPQIVSVMRSRTSKILDTINEDDREFSMNDSHTMIPT 208 RIA+F+TE APPQ +SVMR RTSK+LDTI+E+DR+ + +D M PT Sbjct: 5 RIAKFITEAAPPQYISVMRHRTSKMLDTISEEDRDVAASDPFPMAPT 51 >ref|XP_002519637.1| conserved hypothetical protein [Ricinus communis] gi|223541054|gb|EEF42610.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 62.4 bits (150), Expect = 4e-08 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 11/83 (13%) Frame = -1 Query: 348 RIARFVTEVAPPQIVSVMRSRTSKILDTINEDDREFSMNDSHTMIPTXXXXXXXXXXXXX 169 RIARF+TEVAPPQ +SV+R R SK+LDTINE++R+ S ++S PT Sbjct: 5 RIARFITEVAPPQYISVIRRRASKMLDTINEEERDVSPSNSLASAPTSPASASTNAASAS 64 Query: 168 SC-----------KRIQRAFTIF 133 + +R+QR+F++F Sbjct: 65 AAAPVATNSKYFPRRVQRSFSVF 87 >ref|XP_003607806.1| hypothetical protein MTR_4g083110 [Medicago truncatula] gi|355508861|gb|AES90003.1| hypothetical protein MTR_4g083110 [Medicago truncatula] Length = 85 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 348 RIARFVTEVAPPQIVSVMRSRTSKILDTINEDDREFSMNDS 226 RIARF EVAPPQ VSVMR RTSK+++TI EDDRE + NDS Sbjct: 5 RIARFFMEVAPPQYVSVMRHRTSKMMETITEDDREINSNDS 45 >ref|XP_002305342.1| predicted protein [Populus trichocarpa] gi|222848306|gb|EEE85853.1| predicted protein [Populus trichocarpa] Length = 84 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -1 Query: 348 RIARFVTEVAPPQIVSVMRSRTSKILDTINEDDREFSMNDSHTMIPT 208 RIA+F+TE APPQ ++V+R R SK+LDTI+E+DR+ + +DS M PT Sbjct: 5 RIAKFITEAAPPQYINVIRQRASKLLDTISEEDRDVAASDSSPMSPT 51 >ref|XP_003524154.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 23-like [Glycine max] Length = 621 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 348 RIARFVTEVAPPQIVSVMRSRTSKILDTINEDDREFSMNDS 226 RIARF EVAPPQ V+VMR RTSK+LDTI ED+RE S +DS Sbjct: 5 RIARFFMEVAPPQYVTVMRHRTSKMLDTITEDEREISTSDS 45