BLASTX nr result
ID: Bupleurum21_contig00033826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033826 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago ... 62 5e-08 ref|XP_001753788.1| predicted protein [Physcomitrella patens sub... 57 2e-06 ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|222873229|gb|EEF10360.1| predicted protein [Populus trichocarpa] Length = 88 Score = 63.2 bits (152), Expect = 2e-08 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 4/77 (5%) Frame = -1 Query: 347 MCIPPSHILAEENLVKRLHRYVLRI--SPVVHTRRQGLAP--EADSNKLKQCICSPTRHP 180 MC P +++ NLV R VL+ + H R + A A S + +C+CSPTRHP Sbjct: 1 MCHPGVLSVSQRNLVVYQRRLVLQAVETETSHARTEVAAGGGSAISRSINKCLCSPTRHP 60 Query: 179 GSFRCRQHQTKYVWGSR 129 GSFRCR H++ YVW R Sbjct: 61 GSFRCRHHRSDYVWSGR 77 >ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|222865848|gb|EEF02979.1| predicted protein [Populus trichocarpa] Length = 85 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/77 (41%), Positives = 39/77 (50%), Gaps = 4/77 (5%) Frame = -1 Query: 347 MCIPPSHILAEENLVKRLHRYVLRISPV----VHTRRQGLAPEADSNKLKQCICSPTRHP 180 MC PP NLV VL+ T A + +K+C+CSPTRHP Sbjct: 1 MCHPPGVPWVSRNLVVYRRWLVLQAVETETGHAPTEVAATGSSAVAGSIKKCLCSPTRHP 60 Query: 179 GSFRCRQHQTKYVWGSR 129 GSFRCR H++ YVWG R Sbjct: 61 GSFRCRHHRSDYVWGGR 77 >ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|357521031|ref|XP_003630804.1| hypothetical protein MTR_8g103600 [Medicago truncatula] gi|355523664|gb|AET04118.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|355524826|gb|AET05280.1| hypothetical protein MTR_8g103600 [Medicago truncatula] Length = 83 Score = 62.0 bits (149), Expect = 5e-08 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -1 Query: 227 DSNKLKQCICSPTRHPGSFRCRQHQTKYVWGSRKL 123 + +KQC+CSP++HPGSFRCRQHQ KYVW +R + Sbjct: 48 EDGSIKQCVCSPSKHPGSFRCRQHQAKYVWRNRPI 82 >ref|XP_001753788.1| predicted protein [Physcomitrella patens subsp. patens] gi|162695195|gb|EDQ81540.1| predicted protein [Physcomitrella patens subsp. patens] Length = 221 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/76 (42%), Positives = 43/76 (56%), Gaps = 1/76 (1%) Frame = -1 Query: 347 MCIPPSHILAEENLVKRLHRYVLRISPVVHTRRQGLAPEADSNKLKQCICSPTRHPGSFR 168 +C P SH E + RLHR V+R S + + R + ++ C+C+PT HPGSFR Sbjct: 5 LCAPTSH---EGSFRCRLHREVIR-SVIGASNRGSWSTVRQASAAVPCLCAPTSHPGSFR 60 Query: 167 CRQHQTKY-VWGSRKL 123 CR H+TK WG R L Sbjct: 61 CRLHRTKEPSWGGRPL 76 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 56.2 bits (134), Expect = 3e-06 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -1 Query: 215 LKQCICSPTRHPGSFRCRQHQTKYVWGSR 129 +K C+CSPTRHPGSFRCR H Y WG R Sbjct: 58 IKMCVCSPTRHPGSFRCRHHHVDYAWGRR 86