BLASTX nr result
ID: Bupleurum21_contig00033709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033709 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632935.1| PREDICTED: mitochondrial chaperone BCS1-like... 55 5e-06 >ref|XP_003632935.1| PREDICTED: mitochondrial chaperone BCS1-like [Vitis vinifera] Length = 431 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/65 (40%), Positives = 42/65 (64%) Frame = -3 Query: 196 MTLENMPSAKVVLLIVASIAGSDVLIWSITSELVPANLHDYVFPKVYNFLKYFSWEFTVV 17 + +N SA VL AS+A S +LI SI ++L+P +HDY ++N +YFS + T+V Sbjct: 4 LAFQNRKSAAAVLSTAASLAASAMLIRSIANDLLPNEVHDYFSSTLHNLSRYFSSQLTIV 63 Query: 16 IEEYK 2 I+E++ Sbjct: 64 IDEFQ 68