BLASTX nr result
ID: Bupleurum21_contig00033571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033571 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001242816.1| uncharacterized protein LOC100777963 [Glycin... 83 2e-14 ref|NP_199774.1| amino acid permease 6 [Arabidopsis thaliana] gi... 82 5e-14 ref|XP_003526513.1| PREDICTED: amino acid permease 6-like [Glyci... 82 5e-14 ref|XP_002865746.1| hypothetical protein ARALYDRAFT_495022 [Arab... 82 5e-14 ref|XP_004136237.1| PREDICTED: amino acid permease 6-like [Cucum... 82 6e-14 >ref|NP_001242816.1| uncharacterized protein LOC100777963 [Glycine max] gi|255642183|gb|ACU21356.1| unknown [Glycine max] Length = 479 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +3 Query: 3 VILTILLAMMFPFFNDFVGLLGSIIFWPMTVYFPIEMYIAQKKIPRFS 146 VI+T L+AMMFPFFNDF+GL+GS+ FWP+TVYFPIEMYI Q K+ RFS Sbjct: 390 VIITALIAMMFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQRFS 437 >ref|NP_199774.1| amino acid permease 6 [Arabidopsis thaliana] gi|75220393|sp|P92934.1|AAP6_ARATH RecName: Full=Amino acid permease 6; AltName: Full=Amino acid transporter AAP6 gi|1769887|emb|CAA65051.1| amino acid permease 6 [Arabidopsis thaliana] gi|8809686|dbj|BAA97227.1| amino acid permease 6 [Arabidopsis thaliana] gi|110738094|dbj|BAF00980.1| amino acid permease 6 [Arabidopsis thaliana] gi|332008455|gb|AED95838.1| amino acid permease 6 [Arabidopsis thaliana] Length = 481 Score = 82.0 bits (201), Expect = 5e-14 Identities = 34/48 (70%), Positives = 45/48 (93%) Frame = +3 Query: 3 VILTILLAMMFPFFNDFVGLLGSIIFWPMTVYFPIEMYIAQKKIPRFS 146 V++T ++AM+FPFFNDF+GL+G+ FWP+TVYFPIEM+IAQKKIP+FS Sbjct: 393 VVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIPKFS 440 >ref|XP_003526513.1| PREDICTED: amino acid permease 6-like [Glycine max] Length = 479 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +3 Query: 3 VILTILLAMMFPFFNDFVGLLGSIIFWPMTVYFPIEMYIAQKKIPRFS 146 VI+T L+AMMFPFFNDF+GL+GS+ FWP+TVYFPIEMYI Q K+ +FS Sbjct: 390 VIITALIAMMFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQKFS 437 >ref|XP_002865746.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. lyrata] gi|297311581|gb|EFH42005.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. lyrata] Length = 507 Score = 82.0 bits (201), Expect = 5e-14 Identities = 34/48 (70%), Positives = 45/48 (93%) Frame = +3 Query: 3 VILTILLAMMFPFFNDFVGLLGSIIFWPMTVYFPIEMYIAQKKIPRFS 146 V++T ++AM+FPFFNDF+GL+G+ FWP+TVYFPIEM+IAQKKIP+FS Sbjct: 419 VVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIPKFS 466 >ref|XP_004136237.1| PREDICTED: amino acid permease 6-like [Cucumis sativus] gi|449522221|ref|XP_004168126.1| PREDICTED: amino acid permease 6-like [Cucumis sativus] Length = 477 Score = 81.6 bits (200), Expect = 6e-14 Identities = 34/48 (70%), Positives = 44/48 (91%) Frame = +3 Query: 3 VILTILLAMMFPFFNDFVGLLGSIIFWPMTVYFPIEMYIAQKKIPRFS 146 VILT ++AM+FPFFNDF+GL+G+ FWP+TVYFP+EMYIA+ K+PRFS Sbjct: 390 VILTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPVEMYIARTKLPRFS 437