BLASTX nr result
ID: Bupleurum21_contig00033481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033481 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAY98670.1| hypothetical protein OsI_20597 [Oryza sativa Indi... 57 2e-06 >gb|EAY98670.1| hypothetical protein OsI_20597 [Oryza sativa Indica Group] gi|158937150|dbj|BAF91630.1| CLE family OsCLE508 protein [Oryza sativa Japonica Group] Length = 120 Score = 56.6 bits (135), Expect = 2e-06 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 4/67 (5%) Frame = +1 Query: 136 GGRSHTISATSPPWLPSLSPIY----GKRIYYNYYSPPPLLDEGDEIDLRYGVSKRLVPS 303 GG S +A PP LP + G R ++ +PPP DE E+DLRYGV+KRLVP+ Sbjct: 57 GGGSSRQAAPVPP-LPLCHELMRHRGGVRRHHRRPAPPPGRDE--EVDLRYGVAKRLVPT 113 Query: 304 GPNPLHN 324 GPNPLHN Sbjct: 114 GPNPLHN 120