BLASTX nr result
ID: Bupleurum21_contig00033226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033226 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002443069.1| hypothetical protein SORBIDRAFT_08g007560 [S... 59 3e-07 ref|XP_002459817.1| hypothetical protein SORBIDRAFT_02g011180 [S... 56 3e-06 ref|XP_002468682.1| hypothetical protein SORBIDRAFT_01g050160 [S... 56 3e-06 ref|XP_002464683.1| hypothetical protein SORBIDRAFT_01g023250 [S... 56 3e-06 >ref|XP_002443069.1| hypothetical protein SORBIDRAFT_08g007560 [Sorghum bicolor] gi|241943762|gb|EES16907.1| hypothetical protein SORBIDRAFT_08g007560 [Sorghum bicolor] Length = 713 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 3 MWDVGGDAFAQVEGAGILEIANLSVDEPEMESVLF 107 MWDVGGD F + G GILE+ANLS+DEPEMESV F Sbjct: 663 MWDVGGDGFESLSGVGILEVANLSLDEPEMESVSF 697 >ref|XP_002459817.1| hypothetical protein SORBIDRAFT_02g011180 [Sorghum bicolor] gi|241923194|gb|EER96338.1| hypothetical protein SORBIDRAFT_02g011180 [Sorghum bicolor] Length = 647 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 3 MWDVGGDAFAQVEGAGILEIANLSVDEPEMESVLF 107 MWDVGGD+F + G GILE+ANLSVDEPE+++V F Sbjct: 595 MWDVGGDSFDSLGGIGILEVANLSVDEPELQAVTF 629 >ref|XP_002468682.1| hypothetical protein SORBIDRAFT_01g050160 [Sorghum bicolor] gi|241922536|gb|EER95680.1| hypothetical protein SORBIDRAFT_01g050160 [Sorghum bicolor] Length = 647 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 3 MWDVGGDAFAQVEGAGILEIANLSVDEPEMESVLF 107 MWDVGGD+F + G GILE+ANLSVDEPE+++V F Sbjct: 595 MWDVGGDSFDSLGGIGILEVANLSVDEPELQAVTF 629 >ref|XP_002464683.1| hypothetical protein SORBIDRAFT_01g023250 [Sorghum bicolor] gi|241918537|gb|EER91681.1| hypothetical protein SORBIDRAFT_01g023250 [Sorghum bicolor] Length = 647 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 3 MWDVGGDAFAQVEGAGILEIANLSVDEPEMESVLF 107 MWDVGGD+F + G GILE+ANLSVDEPE+++V F Sbjct: 595 MWDVGGDSFDSLGGIGILEVANLSVDEPELQAVTF 629