BLASTX nr result
ID: Bupleurum21_contig00033224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033224 (469 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76392.1| hypothetical protein VITISV_011465 [Vitis vinifera] 55 6e-06 >emb|CAN76392.1| hypothetical protein VITISV_011465 [Vitis vinifera] Length = 765 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = -2 Query: 426 KVEVDARVIKSGWNKFVKDHKLCEGDFLVFNALGEMLFDVAIFGQNGRIKE 274 +VE D IK+GW +FV+ H + +GDFLVF G+ LFDV+IFG+NG K+ Sbjct: 523 EVEKDV-FIKNGWQEFVRGHSVEQGDFLVFRYHGKALFDVSIFGRNGCRKD 572