BLASTX nr result
ID: Bupleurum21_contig00033117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033117 (643 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW47278.1| ribosomal protein S4 [Lonicera sp. Bergthorsson 0... 76 5e-12 ref|YP_006291840.1| rps4 gene product (mitochondrion) [Daucus ca... 76 5e-12 ref|YP_002608192.1| ribosomal protein S4 [Carica papaya] gi|1705... 76 6e-12 ref|YP_002608399.1| ribosomal protein S4 [Vitis vinifera] gi|209... 76 6e-12 ref|YP_173472.1| ribosomal protein S4 [Nicotiana tabacum] 75 1e-11 >gb|AAW47278.1| ribosomal protein S4 [Lonicera sp. Bergthorsson 0301] Length = 318 Score = 76.3 bits (186), Expect = 5e-12 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -2 Query: 591 SNRVDHNRTKRNV*NFKSLFL*KRSNEKKRNLPT*TRSPIVYNSSLFSNST 439 S+ +HNR KRN+ +FKS+FL KR NEK RNLPT TRSPIVYNSSLFSNST Sbjct: 225 SSFAEHNRMKRNLYHFKSIFLSKRRNEKNRNLPTRTRSPIVYNSSLFSNST 275 >ref|YP_006291840.1| rps4 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081953|gb|AEY81145.1| ribosomal protein S4 (mitochondrion) [Daucus carota subsp. sativus] Length = 279 Score = 76.3 bits (186), Expect = 5e-12 Identities = 39/56 (69%), Positives = 44/56 (78%) Frame = -2 Query: 591 SNRVDHNRTKRNV*NFKSLFL*KRSNEKKRNLPT*TRSPIVYNSSLFSNST*LCTP 424 S+ +HNR KRN+ +FKSLFL KR NEK RNLPT TRSPIVYNSSL+SNST P Sbjct: 161 SSFAEHNRMKRNLYHFKSLFLSKRRNEKNRNLPTRTRSPIVYNSSLYSNSTYCSAP 216 >ref|YP_002608192.1| ribosomal protein S4 [Carica papaya] gi|170522371|gb|ACB20481.1| ribosomal protein S4, partial (mitochondrion) [Carica papaya] Length = 352 Score = 75.9 bits (185), Expect = 6e-12 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -2 Query: 591 SNRVDHNRTKRNV*NFKSLFL*KRSNEKKRNLPT*TRSPIVYNSSLFSNST 439 S+ +HNR KRN+ +FKSLFL KR NEK RNLPT TRSPIVYNSSL+SNST Sbjct: 234 SSFAEHNRMKRNLYHFKSLFLSKRRNEKNRNLPTRTRSPIVYNSSLYSNST 284 >ref|YP_002608399.1| ribosomal protein S4 [Vitis vinifera] gi|209954196|emb|CAQ77661.1| ribosomal protein S4 [Vitis vinifera] gi|239764730|gb|ACS15201.1| ribosomal protein S4 [Vitis vinifera] Length = 362 Score = 75.9 bits (185), Expect = 6e-12 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -2 Query: 591 SNRVDHNRTKRNV*NFKSLFL*KRSNEKKRNLPT*TRSPIVYNSSLFSNST 439 S+ +HNR KRN+ +FKSLFL KR NEK RNLPT TRSPIVYNSSL+SNST Sbjct: 244 SSFAEHNRMKRNLYHFKSLFLSKRRNEKNRNLPTRTRSPIVYNSSLYSNST 294 >ref|YP_173472.1| ribosomal protein S4 [Nicotiana tabacum] Length = 349 Score = 75.1 bits (183), Expect = 1e-11 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -2 Query: 591 SNRVDHNRTKRNV*NFKSLFL*KRSNEKKRNLPT*TRSPIVYNSSLFSNST 439 S+ +HNR KRN+ +FKSLFL KR NEK RN+PT TRSPIVYNSSL+SNST Sbjct: 231 SSFAEHNRMKRNLYHFKSLFLSKRRNEKNRNIPTRTRSPIVYNSSLYSNST 281