BLASTX nr result
ID: Bupleurum21_contig00033079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033079 (722 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20894.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002281569.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 emb|CAN61517.1| hypothetical protein VITISV_033966 [Vitis vinifera] 57 3e-06 ref|XP_002324819.1| predicted protein [Populus trichocarpa] gi|2... 56 9e-06 >emb|CBI20894.3| unnamed protein product [Vitis vinifera] Length = 608 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 632 QVLSLMEEFGVKPDVISFSTIMNAWSAEGF 721 +VL+LMEEFGVKPDVI+FSTIMNAWSA GF Sbjct: 339 EVLTLMEEFGVKPDVITFSTIMNAWSAAGF 368 >ref|XP_002281569.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Vitis vinifera] Length = 635 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 632 QVLSLMEEFGVKPDVISFSTIMNAWSAEGF 721 +VL+LMEEFGVKPDVI+FSTIMNAWSA GF Sbjct: 339 EVLTLMEEFGVKPDVITFSTIMNAWSAAGF 368 >emb|CAN61517.1| hypothetical protein VITISV_033966 [Vitis vinifera] Length = 635 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 632 QVLSLMEEFGVKPDVISFSTIMNAWSAEGF 721 +VL+LMEEFGVKPDVI+FSTIMNAWSA GF Sbjct: 339 EVLTLMEEFGVKPDVITFSTIMNAWSAAGF 368 >ref|XP_002324819.1| predicted protein [Populus trichocarpa] gi|222866253|gb|EEF03384.1| predicted protein [Populus trichocarpa] Length = 552 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 632 QVLSLMEEFGVKPDVISFSTIMNAWSAEGF 721 +VL+LMEEFGVKPDVI+FSTIMNAWS GF Sbjct: 280 EVLNLMEEFGVKPDVITFSTIMNAWSTAGF 309