BLASTX nr result
ID: Bupleurum21_contig00033006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00033006 (593 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532666.1| PREDICTED: mitochondrial translocator assemb... 64 1e-08 ref|XP_003524826.1| PREDICTED: mitochondrial translocator assemb... 64 3e-08 ref|XP_002275625.1| PREDICTED: mitochondrial translocator assemb... 63 3e-08 ref|XP_003638305.1| MMP37-like protein [Medicago truncatula] gi|... 63 4e-08 gb|ACU24231.1| unknown [Glycine max] 62 6e-08 >ref|XP_003532666.1| PREDICTED: mitochondrial translocator assembly and maintenance protein 41 homolog [Glycine max] Length = 325 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +3 Query: 3 KILKKKVMISSARQAVAGLFAVGAAHGARYLAKKMNKAWKSW 128 +IL+++VM+SSARQA++G AVG + RYLAKK+NKAWKSW Sbjct: 283 RILRQRVMVSSARQAISGFLAVGGVNATRYLAKKVNKAWKSW 324 >ref|XP_003524826.1| PREDICTED: mitochondrial translocator assembly and maintenance protein 41 homolog [Glycine max] Length = 325 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/43 (60%), Positives = 38/43 (88%) Frame = +3 Query: 3 KILKKKVMISSARQAVAGLFAVGAAHGARYLAKKMNKAWKSWR 131 +IL+++VM+SSARQA++GL AVG + RYL+KK++KAW+SWR Sbjct: 283 RILRQRVMVSSARQAISGLLAVGGVNATRYLSKKVSKAWRSWR 325 >ref|XP_002275625.1| PREDICTED: mitochondrial translocator assembly and maintenance protein 41 homolog [Vitis vinifera] gi|297738029|emb|CBI27230.3| unnamed protein product [Vitis vinifera] Length = 332 Score = 63.2 bits (152), Expect = 3e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 6 ILKKKVMISSARQAVAGLFAVGAAHGARYLAKKMNKAWKSW 128 +L++KVM+SSARQAV+GL AVG + RYLA KM KAWKSW Sbjct: 291 VLRRKVMVSSARQAVSGLVAVGGVNAIRYLANKMEKAWKSW 331 >ref|XP_003638305.1| MMP37-like protein [Medicago truncatula] gi|355504240|gb|AES85443.1| MMP37-like protein [Medicago truncatula] Length = 331 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = +3 Query: 3 KILKKKVMISSARQAVAGLFAVGAAHGARYLAKKMNKAWKSWR 131 +IL+++VM+SSARQA++GL AVG + Y+A K+NKAWKSWR Sbjct: 289 RILRRRVMVSSARQAISGLLAVGGVNATMYVANKINKAWKSWR 331 >gb|ACU24231.1| unknown [Glycine max] Length = 325 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/43 (60%), Positives = 37/43 (86%) Frame = +3 Query: 3 KILKKKVMISSARQAVAGLFAVGAAHGARYLAKKMNKAWKSWR 131 +IL+++VM+SSARQA++GL AVG + RYL KK++KAW+SWR Sbjct: 283 RILRQRVMVSSARQAISGLLAVGGVNATRYLFKKVSKAWRSWR 325