BLASTX nr result
ID: Bupleurum21_contig00030528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00030528 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63906.1| actin depolymerizing factor 2 [Gossypium hirsutum] 67 2e-09 ref|XP_003535034.1| PREDICTED: actin-depolymerizing factor 2-lik... 67 2e-09 ref|NP_001236448.1| uncharacterized protein LOC100305514 [Glycin... 67 2e-09 gb|ABD66508.1| actin depolymerizing factor 6 [Gossypium hirsutum] 67 2e-09 gb|ABD66505.1| actin depolymerizing factor 3 [Gossypium hirsutum] 67 2e-09 >gb|ABD63906.1| actin depolymerizing factor 2 [Gossypium hirsutum] Length = 139 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 399 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 304 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN Sbjct: 108 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 139 >ref|XP_003535034.1| PREDICTED: actin-depolymerizing factor 2-like [Glycine max] Length = 139 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 399 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 304 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN Sbjct: 108 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 139 >ref|NP_001236448.1| uncharacterized protein LOC100305514 [Glycine max] gi|255625759|gb|ACU13224.1| unknown [Glycine max] Length = 139 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 399 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 304 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN Sbjct: 108 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 139 >gb|ABD66508.1| actin depolymerizing factor 6 [Gossypium hirsutum] Length = 139 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 399 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 304 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN Sbjct: 108 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 139 >gb|ABD66505.1| actin depolymerizing factor 3 [Gossypium hirsutum] Length = 139 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -3 Query: 399 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 304 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN Sbjct: 108 DRFKRELDGIQVELQATDPTEMGLDVFKSRAN 139