BLASTX nr result
ID: Bupleurum21_contig00029377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00029377 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ56957.1| boron transporter [Vitis vinifera] 64 2e-08 ref|XP_002282501.1| PREDICTED: probable boron transporter 2 [Vit... 61 1e-07 gb|ABQ52428.1| boron transporter [Citrus macrophylla] 56 4e-06 >gb|AEZ56957.1| boron transporter [Vitis vinifera] Length = 720 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = -1 Query: 284 DLKAAYSPGASQEAYSPRMNDLK---SIDLNVQGTEIRKIPSPGPSILGQSSHGSPSS 120 D+K AYSP SQ AYSPR+N+L+ S L +G E+ + PSP PSILG+S HGS SS Sbjct: 663 DMKPAYSPRLSQRAYSPRLNELRAEQSPRLTGKGVELNETPSPRPSILGKSPHGSSSS 720 >ref|XP_002282501.1| PREDICTED: probable boron transporter 2 [Vitis vinifera] gi|297733771|emb|CBI15018.3| unnamed protein product [Vitis vinifera] Length = 720 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = -1 Query: 284 DLKAAYSPGASQEAYSPRMNDLK---SIDLNVQGTEIRKIPSPGPSILGQSSHGSPSS 120 D+K AYSP SQ AYSPR+++L+ S +G E+++ PSP PSILG+S HGS SS Sbjct: 663 DMKPAYSPRLSQRAYSPRLSELRAEQSPRFTGKGVELKETPSPRPSILGKSPHGSSSS 720 >gb|ABQ52428.1| boron transporter [Citrus macrophylla] Length = 714 Score = 55.8 bits (133), Expect = 4e-06 Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = -1 Query: 287 EDLKAAYSPGASQEAYSPRMNDLK---SIDLNVQGTEIRKIPSPGPSILGQSSHGS 129 ED ++ +SP + Q AYSPR+ +L+ S L+ +G E++KIPSPGPS LGQSS+GS Sbjct: 657 EDKRSPHSP-SMQRAYSPRVRELRVERSPSLSGKGLEVKKIPSPGPSNLGQSSNGS 711