BLASTX nr result
ID: Bupleurum21_contig00029282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00029282 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328453.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-09 ref|XP_003593155.1| LCR-like protein [Medicago truncatula] gi|30... 63 2e-08 gb|AEZ00849.1| putative brassinosteroid-insensitive protein 1, p... 63 3e-08 ref|XP_003567322.1| PREDICTED: somatic embryogenesis receptor ki... 63 3e-08 ref|NP_197608.1| leucine-rich repeat-containing protein [Arabido... 62 4e-08 >ref|XP_002328453.1| predicted protein [Populus trichocarpa] gi|222838168|gb|EEE76533.1| predicted protein [Populus trichocarpa] Length = 745 Score = 57.8 bits (138), Expect(2) = 7e-09 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +2 Query: 95 LYYFEAYDSNIQGRIPAEIGNLSGLQTLELYGNELTGTIPTTMGRL 232 LYYF ++ I+G IP IGNLSGL TL+L+ N L GTIP T G+L Sbjct: 421 LYYFNLLNNRIRGEIPDSIGNLSGLVTLQLWYNHLDGTIPATFGKL 466 Score = 26.9 bits (58), Expect(2) = 7e-09 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 22 GTLPDEIGKLDAHMIVL-ANNTFTFF 96 G +P+E+GKL+ ++ L +NN FT F Sbjct: 388 GEVPEELGKLNLEILYLHSNNLFTCF 413 >ref|XP_003593155.1| LCR-like protein [Medicago truncatula] gi|308154488|gb|ADO15291.1| somatic embryogenesis receptor kinase 2 [Medicago truncatula] gi|355482203|gb|AES63406.1| LCR-like protein [Medicago truncatula] Length = 619 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/50 (54%), Positives = 40/50 (80%) Frame = +2 Query: 92 SLYYFEAYDSNIQGRIPAEIGNLSGLQTLELYGNELTGTIPTTMGRLIEM 241 +L Y E Y +NI G+IP E+GNL+ L +L+LY N L+GTIPTT+G+L+++ Sbjct: 98 NLQYLELYSNNITGKIPEELGNLTNLVSLDLYLNHLSGTIPTTLGKLLKL 147 >gb|AEZ00849.1| putative brassinosteroid-insensitive protein 1, partial [Elaeis guineensis] Length = 142 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +2 Query: 95 LYYFEAYDSNIQGRIPAEIGNLSGLQTLELYGNELTGTIPTTMGRLIEMVLI 250 L Y E Y +NIQG IPAE+GNL L +L+LY N ++GTIP T+G+L +V + Sbjct: 21 LQYLELYKNNIQGTIPAELGNLKSLISLDLYNNNISGTIPPTLGKLKALVFL 72 >ref|XP_003567322.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Brachypodium distachyon] Length = 218 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +2 Query: 95 LYYFEAYDSNIQGRIPAEIGNLSGLQTLELYGNELTGTIPTTMGRLIEMVLI 250 L Y E Y +NIQG IPAE+GNL+ L +L+LY N +TGTIP +G+L +V + Sbjct: 97 LQYLELYKNNIQGTIPAELGNLNSLISLDLYNNNITGTIPKELGKLRSLVFL 148 >ref|NP_197608.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|11762126|gb|AAG40341.1|AF324989_1 AT5g21090 [Arabidopsis thaliana] gi|13899097|gb|AAK48970.1|AF370543_1 Unknown protein [Arabidopsis thaliana] gi|20148427|gb|AAM10104.1| unknown protein [Arabidopsis thaliana] gi|27311823|gb|AAO00877.1| Unknown protein [Arabidopsis thaliana] gi|29294060|gb|AAO73897.1| leucine rich repeat protein (LRP), putative [Arabidopsis thaliana] gi|30023686|gb|AAP13376.1| At5g21090 [Arabidopsis thaliana] gi|222424256|dbj|BAH20085.1| AT5G21090 [Arabidopsis thaliana] gi|332005547|gb|AED92930.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 218 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +2 Query: 95 LYYFEAYDSNIQGRIPAEIGNLSGLQTLELYGNELTGTIPTTMGRLIEMVLI 250 L Y E Y +NIQG IP+E+GNL L +L+LY N LTG +PT++G+L +V + Sbjct: 96 LQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFL 147