BLASTX nr result
ID: Bupleurum21_contig00027875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00027875 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40311.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002269352.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 77 1e-12 ref|XP_002320781.1| potassium efflux antiporter [Populus trichoc... 75 7e-12 ref|XP_004134330.1| PREDICTED: K(+) efflux antiporter 2, chlorop... 73 3e-11 ref|XP_002302572.1| potassium efflux antiporter [Populus trichoc... 69 4e-10 >emb|CBI40311.3| unnamed protein product [Vitis vinifera] Length = 612 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +1 Query: 1 RHLSELTELCEASGSCLGYGYSRMVSKSKSQPLDFSDEDELSEGTLAI 144 RHLSELTELCEASGS LGYG+SR+ SKSK QP D SDE++++EGTLA+ Sbjct: 565 RHLSELTELCEASGSSLGYGFSRIASKSKPQPPDSSDENQITEGTLAV 612 >ref|XP_002269352.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Vitis vinifera] Length = 1207 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +1 Query: 1 RHLSELTELCEASGSCLGYGYSRMVSKSKSQPLDFSDEDELSEGTLAI 144 RHLSELTELCEASGS LGYG+SR+ SKSK QP D SDE++++EGTLA+ Sbjct: 1160 RHLSELTELCEASGSSLGYGFSRIASKSKPQPPDSSDENQITEGTLAV 1207 >ref|XP_002320781.1| potassium efflux antiporter [Populus trichocarpa] gi|222861554|gb|EEE99096.1| potassium efflux antiporter [Populus trichocarpa] Length = 612 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +1 Query: 1 RHLSELTELCEASGSCLGYGYSRMVSKSKSQPLDFSDEDELSEGTLAI 144 RHLSELTELCE+SGS LGYG+SR+++K K+Q LD SDE++ SEGTLAI Sbjct: 565 RHLSELTELCESSGSSLGYGFSRVMTKPKTQSLDSSDENQFSEGTLAI 612 >ref|XP_004134330.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Cucumis sativus] gi|449480375|ref|XP_004155876.1| PREDICTED: K(+) efflux antiporter 2, chloroplastic-like [Cucumis sativus] Length = 1212 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +1 Query: 1 RHLSELTELCEASGSCLGYGYSRMVSKSKSQPLDFSDEDELSEGTLAI 144 RHLSELTELCEASGS LGYG+SR++SK K Q D SDE++++EGTLAI Sbjct: 1165 RHLSELTELCEASGSSLGYGFSRIMSKPKIQTSDSSDENQVTEGTLAI 1212 >ref|XP_002302572.1| potassium efflux antiporter [Populus trichocarpa] gi|222844298|gb|EEE81845.1| potassium efflux antiporter [Populus trichocarpa] Length = 609 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +1 Query: 1 RHLSELTELCEASGSCLGYGYSRMVSKSKSQPLDFSDEDELSEG 132 RHLSELTELCE SGS LGYG+SR+++K KSQ LD SDE++ SEG Sbjct: 566 RHLSELTELCETSGSSLGYGFSRVMTKPKSQSLDSSDENQFSEG 609