BLASTX nr result
ID: Bupleurum21_contig00026370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026370 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517874.1| phospholipid-transporting atpase, putative [... 64 2e-19 ref|XP_002865375.1| hypothetical protein ARALYDRAFT_356659 [Arab... 63 2e-18 ref|NP_568633.2| phospholipid-translocating ATPase [Arabidopsis ... 63 3e-18 ref|NP_001190471.1| phospholipid-translocating ATPase [Arabidops... 63 3e-18 gb|AAL31943.1|AF419611_1 AT5g44240/MLN1_17 [Arabidopsis thaliana... 63 3e-18 >ref|XP_002517874.1| phospholipid-transporting atpase, putative [Ricinus communis] gi|223542856|gb|EEF44392.1| phospholipid-transporting atpase, putative [Ricinus communis] Length = 715 Score = 63.5 bits (153), Expect(2) = 2e-19 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = +2 Query: 23 LIVAAGMGPILALKYFRYTYRSSKTNILQAAEHSGGP 133 LIVAAGMGPILALKYFRYTYR SK N LQ AE GGP Sbjct: 605 LIVAAGMGPILALKYFRYTYRPSKINTLQQAERLGGP 641 Score = 56.6 bits (135), Expect(2) = 2e-19 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = +1 Query: 124 GRAILSLCRVETRQQKSLEKENYPLLISSPKSRSAVHEPLLSNSPNATRSSG 279 G ILSL +E+ Q +S+EKE PL I+ PKSRS+V+EPLLS+SPN RS G Sbjct: 639 GGPILSLGNIES-QPRSIEKEVSPLSITQPKSRSSVYEPLLSDSPNTRRSFG 689 >ref|XP_002865375.1| hypothetical protein ARALYDRAFT_356659 [Arabidopsis lyrata subsp. lyrata] gi|297311210|gb|EFH41634.1| hypothetical protein ARALYDRAFT_356659 [Arabidopsis lyrata subsp. lyrata] Length = 1096 Score = 62.8 bits (151), Expect(2) = 2e-18 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +2 Query: 23 LIVAAGMGPILALKYFRYTYRSSKTNILQAAEHSGGP 133 LIV AGMGPI ALKYFRYTYR SK NILQ AE GGP Sbjct: 984 LIVGAGMGPIFALKYFRYTYRPSKINILQQAERMGGP 1020 Score = 54.7 bits (130), Expect(2) = 2e-18 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = +1 Query: 124 GRAILSLCRVETRQQKSLEKENYPLLISSPKSRSAVHEPLLSNSPNATRSS 276 G IL+L +ET Q +++EK+ PL I+ PK+RS V+EPLLS+SPNATR S Sbjct: 1018 GGPILTLGNIET-QPRTIEKDLSPLSITQPKNRSPVYEPLLSDSPNATRRS 1067 >ref|NP_568633.2| phospholipid-translocating ATPase [Arabidopsis thaliana] gi|332007695|gb|AED95078.1| phospholipid-translocating ATPase [Arabidopsis thaliana] Length = 1139 Score = 62.8 bits (151), Expect(2) = 3e-18 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +2 Query: 23 LIVAAGMGPILALKYFRYTYRSSKTNILQAAEHSGGP 133 LIV AGMGPI ALKYFRYTYR SK NILQ AE GGP Sbjct: 1027 LIVGAGMGPIFALKYFRYTYRPSKINILQQAERMGGP 1063 Score = 53.9 bits (128), Expect(2) = 3e-18 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +1 Query: 124 GRAILSLCRVETRQQKSLEKENYPLLISSPKSRSAVHEPLLSNSPNATRSS 276 G IL+L +ET Q +++EK+ P+ I+ PK+RS V+EPLLS+SPNATR S Sbjct: 1061 GGPILTLGNIET-QPRTIEKDLSPISITQPKNRSPVYEPLLSDSPNATRRS 1110 >ref|NP_001190471.1| phospholipid-translocating ATPase [Arabidopsis thaliana] gi|12229647|sp|P98205.1|ALA2_ARATH RecName: Full=Phospholipid-transporting ATPase 2; Short=AtALA2; AltName: Full=Aminophospholipid ATPase 2; AltName: Full=Aminophospholipid flippase 2 gi|332007696|gb|AED95079.1| phospholipid-translocating ATPase [Arabidopsis thaliana] Length = 1107 Score = 62.8 bits (151), Expect(2) = 3e-18 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +2 Query: 23 LIVAAGMGPILALKYFRYTYRSSKTNILQAAEHSGGP 133 LIV AGMGPI ALKYFRYTYR SK NILQ AE GGP Sbjct: 995 LIVGAGMGPIFALKYFRYTYRPSKINILQQAERMGGP 1031 Score = 53.9 bits (128), Expect(2) = 3e-18 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +1 Query: 124 GRAILSLCRVETRQQKSLEKENYPLLISSPKSRSAVHEPLLSNSPNATRSS 276 G IL+L +ET Q +++EK+ P+ I+ PK+RS V+EPLLS+SPNATR S Sbjct: 1029 GGPILTLGNIET-QPRTIEKDLSPISITQPKNRSPVYEPLLSDSPNATRRS 1078 >gb|AAL31943.1|AF419611_1 AT5g44240/MLN1_17 [Arabidopsis thaliana] gi|30102492|gb|AAP21164.1| At5g44240/MLN1_17 [Arabidopsis thaliana] Length = 474 Score = 62.8 bits (151), Expect(2) = 3e-18 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = +2 Query: 23 LIVAAGMGPILALKYFRYTYRSSKTNILQAAEHSGGP 133 LIV AGMGPI ALKYFRYTYR SK NILQ AE GGP Sbjct: 362 LIVGAGMGPIFALKYFRYTYRPSKINILQQAERMGGP 398 Score = 53.9 bits (128), Expect(2) = 3e-18 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +1 Query: 124 GRAILSLCRVETRQQKSLEKENYPLLISSPKSRSAVHEPLLSNSPNATRSS 276 G IL+L +ET Q +++EK+ P+ I+ PK+RS V+EPLLS+SPNATR S Sbjct: 396 GGPILTLGNIET-QPRTIEKDLSPISITQPKNRSPVYEPLLSDSPNATRRS 445