BLASTX nr result
ID: Bupleurum21_contig00026340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026340 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307512.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 ref|XP_002524329.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 ref|XP_002300906.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 >ref|XP_002307512.1| predicted protein [Populus trichocarpa] gi|222856961|gb|EEE94508.1| predicted protein [Populus trichocarpa] Length = 201 Score = 67.4 bits (163), Expect = 1e-09 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 3/68 (4%) Frame = +2 Query: 2 NIANKVDIKSSLKKTPSTISGVVNNGN--ETLSKKKINIPGHTER-KVQWMDVYGGKLVE 172 N A KV ++SSLKKT +I V + N E L+ K +IPGHTER KVQW DV G +L E Sbjct: 118 NNAIKVTLRSSLKKTSKSIPVPVEDANQSEPLNDKGSDIPGHTERRKVQWTDVCGSELAE 177 Query: 173 IREYEPRS 196 IRE+EPRS Sbjct: 178 IREFEPRS 185 >ref|XP_002524329.1| conserved hypothetical protein [Ricinus communis] gi|223536420|gb|EEF38069.1| conserved hypothetical protein [Ricinus communis] Length = 206 Score = 64.3 bits (155), Expect = 1e-08 Identities = 36/66 (54%), Positives = 44/66 (66%), Gaps = 3/66 (4%) Frame = +2 Query: 2 NIANKVDIKSSLKKTPSTISGVVNNGNE--TLSKKKINIPGHTER-KVQWMDVYGGKLVE 172 N +V +KSSLKK ++I V N N+ TL +K NIPGH ER KVQW DV G +L E Sbjct: 118 NNVRRVMLKSSLKKPTNSIPVPVENANQHNTLGEKGSNIPGHAERRKVQWTDVCGSELAE 177 Query: 173 IREYEP 190 IRE+EP Sbjct: 178 IREFEP 183 >ref|XP_002300906.1| predicted protein [Populus trichocarpa] gi|222842632|gb|EEE80179.1| predicted protein [Populus trichocarpa] Length = 189 Score = 61.2 bits (147), Expect = 8e-08 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 3/72 (4%) Frame = +2 Query: 2 NIANKVDIKSSLKKTPSTISGVVNN--GNETLSKKKINIPGHTER-KVQWMDVYGGKLVE 172 N A K+ +KS+LKK I V + +E L+ + +IPGHTER KVQW DV G +L E Sbjct: 117 NYARKITLKSNLKKASKRIPVPVEDVKQSEPLNGQGSDIPGHTERRKVQWTDVCGSELAE 176 Query: 173 IREYEPRSKSML 208 IRE+EPR S L Sbjct: 177 IREFEPRYGSTL 188