BLASTX nr result
ID: Bupleurum21_contig00026134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026134 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40732.3| unnamed protein product [Vitis vinifera] 73 2e-11 emb|CAN84084.1| hypothetical protein VITISV_018999 [Vitis vinifera] 72 6e-11 ref|XP_002307761.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 ref|NP_199195.4| pentatricopeptide repeat-containing protein [Ar... 65 8e-09 ref|XP_002510695.1| pentatricopeptide repeat-containing protein,... 64 1e-08 >emb|CBI40732.3| unnamed protein product [Vitis vinifera] Length = 520 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 2 LNNKLLTSNKVEIAYKLFMKIKVARQKENARKHWRSKGWHF 124 LNNKLL SNKVE+AYKLF+KIK+ARQ +NAR+ WR GWHF Sbjct: 480 LNNKLLASNKVEMAYKLFLKIKIARQNDNARRFWRGNGWHF 520 >emb|CAN84084.1| hypothetical protein VITISV_018999 [Vitis vinifera] Length = 561 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 2 LNNKLLTSNKVEIAYKLFMKIKVARQKENARKHWRSKGWHF 124 LNNKLL SNKVE+AYKLF+KIK ARQ +NAR+ WR GWHF Sbjct: 521 LNNKLLASNKVEMAYKLFLKIKXARQNDNARRFWRGNGWHF 561 >ref|XP_002307761.1| predicted protein [Populus trichocarpa] gi|222857210|gb|EEE94757.1| predicted protein [Populus trichocarpa] Length = 563 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +2 Query: 2 LNNKLLTSNKVEIAYKLFMKIKVARQKENARKHWRSKGWHF 124 LNNKLL SNKVE AY+LF+KIK AR ENAR+ WRS GWHF Sbjct: 523 LNNKLLASNKVERAYRLFLKIKHARHSENARRCWRSNGWHF 563 >ref|NP_199195.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635652|sp|P0C8R0.1|PP416_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g43820 gi|332007631|gb|AED95014.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 546 Score = 64.7 bits (156), Expect = 8e-09 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 2 LNNKLLTSNKVEIAYKLFMKIKVARQKENARKHWRSKGWHF 124 L++KL+ SNK E+AYKLF+KIK AR ENAR WRS GWHF Sbjct: 506 LSSKLMASNKTELAYKLFLKIKKARATENARSFWRSNGWHF 546 >ref|XP_002510695.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551396|gb|EEF52882.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 195 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 2 LNNKLLTSNKVEIAYKLFMKIKVARQKENARKHWRSKGWHF 124 LNNKLL S+KVE AYKL++K++ AR ENAR+ WR+ GWHF Sbjct: 155 LNNKLLASSKVERAYKLYLKVRDARSNENARRFWRANGWHF 195