BLASTX nr result
ID: Bupleurum21_contig00026010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00026010 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285740.1| PREDICTED: uncharacterized protein LOC100260... 78 9e-13 ref|XP_002523411.1| hypothetical protein RCOM_0343080 [Ricinus c... 69 4e-10 ref|XP_002304851.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|XP_002299100.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002334049.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002285740.1| PREDICTED: uncharacterized protein LOC100260500 [Vitis vinifera] gi|297746488|emb|CBI16544.3| unnamed protein product [Vitis vinifera] Length = 134 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 81 MRVLFCKIHCPSFICFCKPSAAAHLYTSGPLKLDNNPHVLP 203 MRVLFCKIHCPSFICFCKPS H+YT GPLKL+NNPHV P Sbjct: 1 MRVLFCKIHCPSFICFCKPS--PHIYTPGPLKLENNPHVPP 39 >ref|XP_002523411.1| hypothetical protein RCOM_0343080 [Ricinus communis] gi|223537361|gb|EEF38990.1| hypothetical protein RCOM_0343080 [Ricinus communis] Length = 125 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 81 MRVLFCKIHCPSFICFCKPSAAAHLYTSGPLKLDNNPHV 197 MRVLFCKIHCPSFICFCKPSA+ +GPLKL++ PHV Sbjct: 1 MRVLFCKIHCPSFICFCKPSASLLYTAAGPLKLESRPHV 39 >ref|XP_002304851.1| predicted protein [Populus trichocarpa] gi|222842283|gb|EEE79830.1| predicted protein [Populus trichocarpa] Length = 127 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 81 MRVLFCKIHCPSFICFCKPSAAAHLYTSGPLKLDNNPHV 197 MRVLF KIHCPSFICFCKPS + +YT GPLKL+N+PHV Sbjct: 1 MRVLFSKIHCPSFICFCKPSPS--IYTPGPLKLENSPHV 37 >ref|XP_002299100.1| predicted protein [Populus trichocarpa] gi|222846358|gb|EEE83905.1| predicted protein [Populus trichocarpa] Length = 149 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 75 IFMRVLFCKIHCPSFICFCKPSAAAHLYTSGPLKLDNNPHV 197 +FMRVLFCKIHCP FICFCKPS +Y PLKL+N+PHV Sbjct: 16 LFMRVLFCKIHCP-FICFCKPS--PRIYGPAPLKLENSPHV 53 >ref|XP_002334049.1| predicted protein [Populus trichocarpa] gi|222839667|gb|EEE77990.1| predicted protein [Populus trichocarpa] Length = 132 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 81 MRVLFCKIHCPSFICFCKPSAAAHLYTSGPLKLDNNPHV 197 MRVLFCKIHCP FICFCKPS +Y PLKL+N+PHV Sbjct: 1 MRVLFCKIHCP-FICFCKPS--PRIYGPAPLKLENSPHV 36