BLASTX nr result
ID: Bupleurum21_contig00025827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025827 (643 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147505.1| PREDICTED: carbonic anhydrase 2, chloroplast... 90 4e-16 ref|XP_003631728.1| PREDICTED: carbonic anhydrase 2, chloroplast... 87 2e-15 ref|XP_002263870.2| PREDICTED: carbonic anhydrase 2, chloroplast... 87 2e-15 emb|CBI34003.3| unnamed protein product [Vitis vinifera] 87 2e-15 emb|CAN64241.1| hypothetical protein VITISV_005703 [Vitis vinifera] 87 2e-15 >ref|XP_004147505.1| PREDICTED: carbonic anhydrase 2, chloroplastic-like [Cucumis sativus] gi|449527019|ref|XP_004170510.1| PREDICTED: carbonic anhydrase 2, chloroplastic-like [Cucumis sativus] Length = 300 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/68 (61%), Positives = 46/68 (67%) Frame = -2 Query: 372 KVSINNSLSNLLAYPWIRERVSKGLLSIHGGYYDFVNCTFEKWQLDYQXXXXXXXXXXXX 193 K S+NNSL NLL YPWI E+V KG LSIHGGYYDFV+CTFEKW LDY+ Sbjct: 233 KESLNNSLLNLLTYPWIEEKVKKGNLSIHGGYYDFVDCTFEKWTLDYEASNFNEETRRLA 292 Query: 192 XXXREFWS 169 REFWS Sbjct: 293 VKNREFWS 300 >ref|XP_003631728.1| PREDICTED: carbonic anhydrase 2, chloroplastic-like isoform 2 [Vitis vinifera] Length = 262 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -2 Query: 372 KVSINNSLSNLLAYPWIRERVSKGLLSIHGGYYDFVNCTFEKWQLDYQ 229 K SIN SL NLL YPWI+ERV +G+LSIHGGYYDFVNCTFEKW LDY+ Sbjct: 201 KESINCSLLNLLTYPWIKERVERGMLSIHGGYYDFVNCTFEKWTLDYK 248 >ref|XP_002263870.2| PREDICTED: carbonic anhydrase 2, chloroplastic-like isoform 1 [Vitis vinifera] Length = 300 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -2 Query: 372 KVSINNSLSNLLAYPWIRERVSKGLLSIHGGYYDFVNCTFEKWQLDYQ 229 K SIN SL NLL YPWI+ERV +G+LSIHGGYYDFVNCTFEKW LDY+ Sbjct: 239 KESINCSLLNLLTYPWIKERVERGMLSIHGGYYDFVNCTFEKWTLDYK 286 >emb|CBI34003.3| unnamed protein product [Vitis vinifera] Length = 301 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -2 Query: 372 KVSINNSLSNLLAYPWIRERVSKGLLSIHGGYYDFVNCTFEKWQLDYQ 229 K SIN SL NLL YPWI+ERV +G+LSIHGGYYDFVNCTFEKW LDY+ Sbjct: 240 KESINCSLLNLLTYPWIKERVERGMLSIHGGYYDFVNCTFEKWTLDYK 287 >emb|CAN64241.1| hypothetical protein VITISV_005703 [Vitis vinifera] Length = 211 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -2 Query: 372 KVSINNSLSNLLAYPWIRERVSKGLLSIHGGYYDFVNCTFEKWQLDYQ 229 K SIN SL NLL YPWI+ERV +G+LSIHGGYYDFVNCTFEKW LDY+ Sbjct: 150 KESINCSLLNLLTYPWIKERVERGMLSIHGGYYDFVNCTFEKWTLDYK 197