BLASTX nr result
ID: Bupleurum21_contig00025480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025480 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002874330.1| kelch repeat-containing F-box family protein... 100 2e-19 dbj|BAD43758.1| putative protein [Arabidopsis thaliana] 98 6e-19 gb|AAB61064.1| contains similarity to MIPP proteins [Arabidopsis... 98 6e-19 ref|NP_198048.1| F-box/kelch-repeat protein [Arabidopsis thalian... 98 6e-19 ref|XP_002268943.1| PREDICTED: F-box/kelch-repeat protein At5g26... 97 1e-18 >ref|XP_002874330.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297320167|gb|EFH50589.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 410 Score = 100 bits (248), Expect = 2e-19 Identities = 46/91 (50%), Positives = 64/91 (70%), Gaps = 2/91 (2%) Frame = -1 Query: 267 SMDLYDVEAREWLKSQXXXXXXXXXXXXXXXGYLYVLASHAVELSFWRFNGCRN--DKRY 94 SMDL+DVE+R+WL+S+ Y+YVL+SHAVELSFWRF+ R + + Sbjct: 261 SMDLFDVESRQWLRSRSVPGGGCVVAACAAVRYVYVLSSHAVELSFWRFDARRRGGNSGF 320 Query: 93 KEWRRIDAPPMPAQVRVDSSVRFSCIGIGEK 1 EWRR+ +PP+PAQVR+D +VRFSC+G+ +K Sbjct: 321 GEWRRLKSPPLPAQVRLDGTVRFSCVGVEDK 351 >dbj|BAD43758.1| putative protein [Arabidopsis thaliana] Length = 412 Score = 98.2 bits (243), Expect = 6e-19 Identities = 46/91 (50%), Positives = 64/91 (70%), Gaps = 2/91 (2%) Frame = -1 Query: 267 SMDLYDVEAREWLKSQXXXXXXXXXXXXXXXGYLYVLASHAVELSFWRFNGCRN--DKRY 94 SMDL+DVE+R+WL+S+ GY+YVL SHAVELSFWRF+ R + + Sbjct: 263 SMDLFDVESRQWLRSRSVPGGGCVVAACAAVGYVYVLTSHAVELSFWRFDARRRGGNSGF 322 Query: 93 KEWRRIDAPPMPAQVRVDSSVRFSCIGIGEK 1 EW+R+ +PP+PAQVR+D +VRFSC+G+ +K Sbjct: 323 GEWQRLKSPPLPAQVRLDGTVRFSCVGVEDK 353 >gb|AAB61064.1| contains similarity to MIPP proteins [Arabidopsis thaliana] Length = 704 Score = 98.2 bits (243), Expect = 6e-19 Identities = 46/91 (50%), Positives = 64/91 (70%), Gaps = 2/91 (2%) Frame = -1 Query: 267 SMDLYDVEAREWLKSQXXXXXXXXXXXXXXXGYLYVLASHAVELSFWRFNGCRN--DKRY 94 SMDL+DVE+R+WL+S+ GY+YVL SHAVELSFWRF+ R + + Sbjct: 264 SMDLFDVESRQWLRSRSVPGGGCVVAACAAVGYVYVLTSHAVELSFWRFDARRRGGNSGF 323 Query: 93 KEWRRIDAPPMPAQVRVDSSVRFSCIGIGEK 1 EW+R+ +PP+PAQVR+D +VRFSC+G+ +K Sbjct: 324 GEWQRLKSPPLPAQVRLDGTVRFSCVGVEDK 354 >ref|NP_198048.1| F-box/kelch-repeat protein [Arabidopsis thaliana] gi|75127127|sp|Q6NPN5.1|FK113_ARATH RecName: Full=F-box/kelch-repeat protein At5g26960 gi|38603834|gb|AAR24662.1| At5g26960 [Arabidopsis thaliana] gi|332006251|gb|AED93634.1| F-box/kelch-repeat protein [Arabidopsis thaliana] Length = 413 Score = 98.2 bits (243), Expect = 6e-19 Identities = 46/91 (50%), Positives = 64/91 (70%), Gaps = 2/91 (2%) Frame = -1 Query: 267 SMDLYDVEAREWLKSQXXXXXXXXXXXXXXXGYLYVLASHAVELSFWRFNGCRN--DKRY 94 SMDL+DVE+R+WL+S+ GY+YVL SHAVELSFWRF+ R + + Sbjct: 264 SMDLFDVESRQWLRSRSVPGGGCVVAACAAVGYVYVLTSHAVELSFWRFDARRRGGNSGF 323 Query: 93 KEWRRIDAPPMPAQVRVDSSVRFSCIGIGEK 1 EW+R+ +PP+PAQVR+D +VRFSC+G+ +K Sbjct: 324 GEWQRLKSPPLPAQVRLDGTVRFSCVGVEDK 354 >ref|XP_002268943.1| PREDICTED: F-box/kelch-repeat protein At5g26960-like [Vitis vinifera] Length = 416 Score = 97.1 bits (240), Expect = 1e-18 Identities = 49/94 (52%), Positives = 62/94 (65%), Gaps = 6/94 (6%) Frame = -1 Query: 267 SMDLYDVEAREWLKSQXXXXXXXXXXXXXXXGYLYVLASHAVELSFWRFNGCRNDKR--- 97 SMDLYDVEAR WL+S+ G++YVL SHAVELSFWRF+ R Sbjct: 263 SMDLYDVEARGWLRSRAVPSGGCVVAACAAAGFVYVLTSHAVELSFWRFDARRKATSGSG 322 Query: 96 ---YKEWRRIDAPPMPAQVRVDSSVRFSCIGIGE 4 + EW R+ +PP+PAQVR+DSSVRFSC+G+G+ Sbjct: 323 GGGFGEWCRMKSPPLPAQVRLDSSVRFSCVGVGD 356