BLASTX nr result
ID: Bupleurum21_contig00025360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025360 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320775.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolo... 72 4e-11 ref|XP_004133877.1| PREDICTED: cell division protein FtsY homolo... 71 8e-11 ref|XP_003528876.1| PREDICTED: cell division protein ftsY homolo... 71 8e-11 dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgar... 71 8e-11 >ref|XP_002320775.1| predicted protein [Populus trichocarpa] gi|222861548|gb|EEE99090.1| predicted protein [Populus trichocarpa] Length = 365 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 426 VVSVVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIFS 313 VVSVVDELGIPVKFVGVGEGV+DLQPFDAE FV+AIFS Sbjct: 328 VVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFS 365 >ref|XP_002269433.1| PREDICTED: cell division protein FtsY homolog, chloroplastic [Vitis vinifera] gi|296089055|emb|CBI38758.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -3 Query: 426 VVSVVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIFS 313 VVSVVDELGIPVKFVGVGEGV+DLQPFDAE FV+AIFS Sbjct: 330 VVSVVDELGIPVKFVGVGEGVEDLQPFDAEVFVNAIFS 367 >ref|XP_004133877.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cucumis sativus] gi|449480150|ref|XP_004155813.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cucumis sativus] Length = 368 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -3 Query: 426 VVSVVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIFS 313 VVSVVDELGIPVKFVGVGEG++DLQPFD E FVDAIFS Sbjct: 331 VVSVVDELGIPVKFVGVGEGLEDLQPFDPEAFVDAIFS 368 >ref|XP_003528876.1| PREDICTED: cell division protein ftsY homolog [Glycine max] Length = 372 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 426 VVSVVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIF 316 VVSVVDELGIPVKFVGVGEGV+DLQPFDAE+FV+AIF Sbjct: 335 VVSVVDELGIPVKFVGVGEGVEDLQPFDAESFVNAIF 371 >dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532852|dbj|BAJ89271.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 355 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 426 VVSVVDELGIPVKFVGVGEGVDDLQPFDAETFVDAIF 316 VVSVVDELGIPVKFVGVGEGV+DLQPFDAE FV+AIF Sbjct: 318 VVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIF 354