BLASTX nr result
ID: Bupleurum21_contig00025329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025329 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003564932.1| PREDICTED: ectonucleotide pyrophosphatase/ph... 64 1e-08 ref|XP_003517374.1| PREDICTED: ectonucleotide pyrophosphatase/ph... 62 4e-08 ref|XP_003524421.1| PREDICTED: ectonucleotide pyrophosphatase/ph... 62 6e-08 ref|XP_002514102.1| ectonucleotide pyrophosphatase/phosphodieste... 62 6e-08 ref|XP_002457182.1| hypothetical protein SORBIDRAFT_03g002880 [S... 60 1e-07 >ref|XP_003564932.1| PREDICTED: ectonucleotide pyrophosphatase/phosphodiesterase family member 3-like [Brachypodium distachyon] Length = 473 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 289 LARPQSKLPHPVVLMISCDGFRFGYQYKTPTPNIKR 396 LARP SKLP PVVL+IS DGFRFGYQYK PTP+I+R Sbjct: 74 LARPLSKLPKPVVLLISSDGFRFGYQYKVPTPHIRR 109 >ref|XP_003517374.1| PREDICTED: ectonucleotide pyrophosphatase/phosphodiesterase family member 3-like [Glycine max] Length = 462 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 289 LARPQSKLPHPVVLMISCDGFRFGYQYKTPTPNIKR 396 L P++KLPHPVV++IS DGFRFGYQ+KTP PNI+R Sbjct: 63 LPPPRAKLPHPVVILISSDGFRFGYQFKTPAPNIQR 98 >ref|XP_003524421.1| PREDICTED: ectonucleotide pyrophosphatase/phosphodiesterase family member 1-like [Glycine max] Length = 487 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 283 VLLARPQSKLPHPVVLMISCDGFRFGYQYKTPTPNIKR 396 +L+ARP SKL PVVL++S DGFRFGYQ+KTPTP+I R Sbjct: 85 LLVARPLSKLKRPVVLLVSSDGFRFGYQFKTPTPHISR 122 >ref|XP_002514102.1| ectonucleotide pyrophosphatase/phosphodiesterase, putative [Ricinus communis] gi|223546558|gb|EEF48056.1| ectonucleotide pyrophosphatase/phosphodiesterase, putative [Ricinus communis] Length = 548 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 292 ARPQSKLPHPVVLMISCDGFRFGYQYKTPTPNIKR 396 +RP +KL HPVVL+IS DGFRFGYQ+KTPTPNI R Sbjct: 91 SRPLTKLNHPVVLLISSDGFRFGYQFKTPTPNIHR 125 >ref|XP_002457182.1| hypothetical protein SORBIDRAFT_03g002880 [Sorghum bicolor] gi|241929157|gb|EES02302.1| hypothetical protein SORBIDRAFT_03g002880 [Sorghum bicolor] Length = 470 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 292 ARPQSKLPHPVVLMISCDGFRFGYQYKTPTPNIKR 396 ARP SKLP PVVL+IS DGFRFGYQYK P P+I+R Sbjct: 72 ARPLSKLPKPVVLLISSDGFRFGYQYKAPLPHIRR 106