BLASTX nr result
ID: Bupleurum21_contig00025319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025319 (490 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519172.1| conserved hypothetical protein [Ricinus comm... 98 8e-19 ref|XP_002314324.1| predicted protein [Populus trichocarpa] gi|2... 96 2e-18 ref|XP_004166018.1| PREDICTED: uncharacterized LOC101208769 [Cuc... 91 7e-17 ref|XP_004134231.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 91 7e-17 ref|XP_002328611.1| predicted protein [Populus trichocarpa] gi|2... 91 1e-16 >ref|XP_002519172.1| conserved hypothetical protein [Ricinus communis] gi|223541487|gb|EEF43036.1| conserved hypothetical protein [Ricinus communis] Length = 416 Score = 97.8 bits (242), Expect = 8e-19 Identities = 45/62 (72%), Positives = 48/62 (77%) Frame = -1 Query: 490 QLSLPIFGLAPYKFKVSDWSPAGEYDCQKVKSLFREADNWLRLLQVDHPDYKFFLSHNSL 311 +L L FGLA YKFKVS W+P G Y+CQKV SL R ADNWLRLLQV HPDY FF SHNS Sbjct: 355 KLPLATFGLASYKFKVSFWNPNGAYECQKVNSLLRAADNWLRLLQVYHPDYMFFASHNSN 414 Query: 310 WR 305 WR Sbjct: 415 WR 416 >ref|XP_002314324.1| predicted protein [Populus trichocarpa] gi|222863364|gb|EEF00495.1| predicted protein [Populus trichocarpa] Length = 397 Score = 96.3 bits (238), Expect = 2e-18 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = -1 Query: 490 QLSLPIFGLAPYKFKVSDWSPAGEYDCQKVKSLFREADNWLRLLQVDHPDYKFFLSHNS 314 +L LP FGLA YKFKVS W+P G Y+CQK SL R ADNWLRLLQV+HPDY+FF+SHN+ Sbjct: 336 KLPLPTFGLASYKFKVSFWNPNGVYECQKASSLLRAADNWLRLLQVNHPDYRFFVSHNT 394 >ref|XP_004166018.1| PREDICTED: uncharacterized LOC101208769 [Cucumis sativus] Length = 428 Score = 91.3 bits (225), Expect = 7e-17 Identities = 38/62 (61%), Positives = 48/62 (77%) Frame = -1 Query: 490 QLSLPIFGLAPYKFKVSDWSPAGEYDCQKVKSLFREADNWLRLLQVDHPDYKFFLSHNSL 311 +L LPIFGLA YKFK+ W+ G +C K SL+++AD+WLRLL V+HPDY+FF SHNS Sbjct: 367 KLQLPIFGLASYKFKIPFWNSTGAEECSKAHSLWQDADSWLRLLNVNHPDYRFFASHNSF 426 Query: 310 WR 305 WR Sbjct: 427 WR 428 >ref|XP_004134231.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101208769 [Cucumis sativus] Length = 420 Score = 91.3 bits (225), Expect = 7e-17 Identities = 38/62 (61%), Positives = 48/62 (77%) Frame = -1 Query: 490 QLSLPIFGLAPYKFKVSDWSPAGEYDCQKVKSLFREADNWLRLLQVDHPDYKFFLSHNSL 311 +L LPIFGLA YKFK+ W+ G +C K SL+++AD+WLRLL V+HPDY+FF SHNS Sbjct: 359 KLQLPIFGLASYKFKIPFWNSTGAEECSKAHSLWQDADSWLRLLNVNHPDYRFFASHNSF 418 Query: 310 WR 305 WR Sbjct: 419 WR 420 >ref|XP_002328611.1| predicted protein [Populus trichocarpa] gi|222838593|gb|EEE76958.1| predicted protein [Populus trichocarpa] Length = 315 Score = 90.9 bits (224), Expect = 1e-16 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = -1 Query: 490 QLSLPIFGLAPYKFKVSDWSPAGEYDCQKVKSLFREADNWLRLLQVDHPDYKFFLSHNS 314 +L LP FGLA YKF+V+ W+P G Y+CQK SL + ADNWLRLLQV+HPDY+FF+SHN+ Sbjct: 254 KLPLPTFGLASYKFEVTFWNPNGVYECQKSGSLLKAADNWLRLLQVNHPDYRFFVSHNT 312