BLASTX nr result
ID: Bupleurum21_contig00025301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025301 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL54887.1|AF092916_1 cytochrome P450-dependent fatty acid hy... 87 2e-15 gb|AAL54886.1|AF092915_1 cytochrome P450-dependent fatty acid hy... 85 7e-15 ref|XP_002306826.1| cytochrome P450 [Populus trichocarpa] gi|222... 84 9e-15 ref|XP_002336002.1| cytochrome P450 [Populus trichocarpa] gi|222... 84 9e-15 ref|XP_002335046.1| cytochrome P450 [Populus trichocarpa] gi|222... 84 9e-15 >gb|AAL54887.1|AF092916_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum] Length = 511 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -3 Query: 313 KEMAFLQMKRVVAGILPEFRVVPVIEKGKEPVFVSYLTAKMEGGFPVRIQQR 158 KEMAFLQMKRVVAG+L F+VVPV+E+G EPVF+SYLTAKM+GGFPV I++R Sbjct: 459 KEMAFLQMKRVVAGVLRRFKVVPVVEQGVEPVFISYLTAKMKGGFPVTIEER 510 >gb|AAL54886.1|AF092915_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum] Length = 511 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -3 Query: 313 KEMAFLQMKRVVAGILPEFRVVPVIEKGKEPVFVSYLTAKMEGGFPVRIQQR 158 KEMAFLQMKRVVAG+L F+VVP+ EKG EPVF+SYLTAKM+GGFPV I++R Sbjct: 455 KEMAFLQMKRVVAGVLRRFKVVPLAEKGVEPVFLSYLTAKMKGGFPVTIEER 506 >ref|XP_002306826.1| cytochrome P450 [Populus trichocarpa] gi|222856275|gb|EEE93822.1| cytochrome P450 [Populus trichocarpa] Length = 372 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -3 Query: 313 KEMAFLQMKRVVAGILPEFRVVPVIEKGKEPVFVSYLTAKMEGGFPVRIQQRA 155 K+MAFLQMKRVVAGIL F+VVP E+G EPVFVSYLT+KM+GGFPVR ++RA Sbjct: 319 KDMAFLQMKRVVAGILRRFKVVPAAEEGFEPVFVSYLTSKMQGGFPVRFEERA 371 >ref|XP_002336002.1| cytochrome P450 [Populus trichocarpa] gi|222838370|gb|EEE76735.1| cytochrome P450 [Populus trichocarpa] Length = 507 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -3 Query: 313 KEMAFLQMKRVVAGILPEFRVVPVIEKGKEPVFVSYLTAKMEGGFPVRIQQRA 155 K+MAFLQMKRVVAGIL F+VVP E+G EPVFVSYLT+KM+GGFPVR ++RA Sbjct: 454 KDMAFLQMKRVVAGILRRFKVVPAAEEGFEPVFVSYLTSKMQGGFPVRFEERA 506 >ref|XP_002335046.1| cytochrome P450 [Populus trichocarpa] gi|222832699|gb|EEE71176.1| cytochrome P450 [Populus trichocarpa] Length = 507 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -3 Query: 313 KEMAFLQMKRVVAGILPEFRVVPVIEKGKEPVFVSYLTAKMEGGFPVRIQQRA 155 K+MAFLQMKRVVAGIL F+VVP E+G EPVFVSYLT+KM+GGFPVR ++RA Sbjct: 454 KDMAFLQMKRVVAGILRRFKVVPAAEEGFEPVFVSYLTSKMQGGFPVRFEERA 506