BLASTX nr result
ID: Bupleurum21_contig00025262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00025262 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619232.1| Kinase-like protein [Medicago truncatula] gi... 60 2e-07 ref|XP_002267821.2| PREDICTED: probable receptor-like protein ki... 59 3e-07 ref|XP_002263106.2| PREDICTED: probable receptor-like protein ki... 59 4e-07 ref|XP_002267723.1| PREDICTED: probable receptor-like protein ki... 59 4e-07 ref|XP_003543805.1| PREDICTED: probable receptor-like protein ki... 57 2e-06 >ref|XP_003619232.1| Kinase-like protein [Medicago truncatula] gi|355494247|gb|AES75450.1| Kinase-like protein [Medicago truncatula] Length = 423 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +1 Query: 1 PSERPSMNKVIEMLDTDVEQLVMPPKPFLYPQEVQVEDLEPGVKIEERE 147 PS+RPSMN+VIEML+ D+E + MPPKP LYP E+ EDL+ E E Sbjct: 366 PSDRPSMNRVIEMLEGDIENVEMPPKPSLYPNEMIEEDLDVNSNETESE 414 >ref|XP_002267821.2| PREDICTED: probable receptor-like protein kinase At1g67000-like [Vitis vinifera] Length = 625 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +1 Query: 1 PSERPSMNKVIEMLDTDVEQLVMPPKPFLYPQEVQVED 114 PS+RPSMNKV+EML+ +VE L MPPKPFL P+EV ED Sbjct: 573 PSDRPSMNKVVEMLEENVELLQMPPKPFLTPREVLAED 610 >ref|XP_002263106.2| PREDICTED: probable receptor-like protein kinase At1g67000-like [Vitis vinifera] Length = 603 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 PSERPSMNKVIEMLDTDVEQLVMPPKPFLYPQEVQVEDLEPGVKIEEREPAIPDLTV 171 PS+RPSMNKV+EML+ +VE L MPPKP L PQEV ED + ++PA +++ Sbjct: 551 PSDRPSMNKVVEMLEGNVELLQMPPKPLLTPQEVPAED-----HVNNKKPAEMSISI 602 >ref|XP_002267723.1| PREDICTED: probable receptor-like protein kinase At1g67000-like [Vitis vinifera] Length = 598 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +1 Query: 1 PSERPSMNKVIEMLDTDVEQLVMPPKPFLYPQEVQVED 114 PS+RPSM+KV+EML+ +VE L MPPKPFL PQEV ED Sbjct: 560 PSDRPSMSKVVEMLEGNVELLQMPPKPFLTPQEVPAED 597 >ref|XP_003543805.1| PREDICTED: probable receptor-like protein kinase At5g39020-like [Glycine max] Length = 513 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = +1 Query: 1 PSERPSMNKVIEMLDTDVEQLVMPPKPFLYPQEVQVEDLEPGVKIE 138 P++RPSMNKV+EML+ D+E L +PPKP LYP E + D IE Sbjct: 468 PNDRPSMNKVVEMLEGDIENLEIPPKPTLYPHETTIRDQRTPNNIE 513