BLASTX nr result
ID: Bupleurum21_contig00024974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00024974 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512191.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 ref|XP_002271097.1| PREDICTED: uncharacterized protein LOC100266... 55 8e-06 >ref|XP_002512191.1| conserved hypothetical protein [Ricinus communis] gi|223548735|gb|EEF50225.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = +1 Query: 151 MLIENGLGDMILKVALFVLVQALVYLILTKSSNVFSS 261 M++E+ LGDM+LKVA+F LVQALVY+IL+KSSN+FS+ Sbjct: 2 MIMESSLGDMLLKVAMFALVQALVYIILSKSSNIFSN 38 >ref|XP_002271097.1| PREDICTED: uncharacterized protein LOC100266637 [Vitis vinifera] Length = 95 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 151 MLIENGLGDMILKVALFVLVQALVYLILTKSSNVFS 258 M E+ L DM+LKV +FVLVQALVYLIL+KSSN+FS Sbjct: 1 MAFESSLADMVLKVGMFVLVQALVYLILSKSSNIFS 36