BLASTX nr result
ID: Bupleurum21_contig00024858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00024858 (526 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515032.1| hypothetical protein RCOM_1082870 [Ricinus c... 55 6e-06 >ref|XP_002515032.1| hypothetical protein RCOM_1082870 [Ricinus communis] gi|223546083|gb|EEF47586.1| hypothetical protein RCOM_1082870 [Ricinus communis] Length = 1078 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/51 (58%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 328 VEKPRSNSKPMSINEILRSSSRFKKAKL-AAESQPGDSESQPIDFVPDSQA 179 + KP S+ ++++ ILRSSSR+KKAKL AA+ Q D+ESQP++FVPDSQA Sbjct: 1028 IRKPLSSG--LTLDAILRSSSRYKKAKLTAAQLQLEDTESQPVEFVPDSQA 1076