BLASTX nr result
ID: Bupleurum21_contig00024841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00024841 (555 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520671.1| glutaredoxin, grx, putative [Ricinus communi... 139 4e-31 ref|XP_002873906.1| glutaredoxin family protein [Arabidopsis lyr... 138 7e-31 gb|ACH63240.1| glutaredoxin [Rheum australe] 135 3e-30 ref|XP_004143084.1| PREDICTED: monothiol glutaredoxin-S2-like [C... 134 7e-30 ref|NP_197361.1| monothiol glutaredoxin-S2 [Arabidopsis thaliana... 132 4e-29 >ref|XP_002520671.1| glutaredoxin, grx, putative [Ricinus communis] gi|223540056|gb|EEF41633.1| glutaredoxin, grx, putative [Ricinus communis] Length = 102 Score = 139 bits (349), Expect = 4e-31 Identities = 66/101 (65%), Positives = 81/101 (80%) Frame = +1 Query: 10 MATVTRLGTEYPVVIFSKSSCCMSHSIKTLISSFGANPAVYELDEMPNGQQMERELKALG 189 M V RL E PVVIFSKSSCCMSH+IK+LI FGANP VYELD +PNGQQ+ER L LG Sbjct: 1 MEMVNRLVKEKPVVIFSKSSCCMSHTIKSLICGFGANPTVYELDRIPNGQQIERTLMQLG 60 Query: 190 RKPIIPAVFIGKELIGGPNEVMSLHVKGKLVPLLLQAKAIW 312 +P +P+VFIG++L+GG +VMSLHV+ +L+PLL+ A AIW Sbjct: 61 CQPSVPSVFIGQKLVGGEKQVMSLHVQNQLIPLLIDAGAIW 101 >ref|XP_002873906.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297319743|gb|EFH50165.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] Length = 102 Score = 138 bits (347), Expect = 7e-31 Identities = 64/101 (63%), Positives = 80/101 (79%) Frame = +1 Query: 10 MATVTRLGTEYPVVIFSKSSCCMSHSIKTLISSFGANPAVYELDEMPNGQQMERELKALG 189 M +T++ E PVVI+SKSSCCMSH+IKTL+ FGANPAVYELDE+P G+ +ER L LG Sbjct: 1 MDMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELDELPRGRDIERALLRLG 60 Query: 190 RKPIIPAVFIGKELIGGPNEVMSLHVKGKLVPLLLQAKAIW 312 P +PAVFIG EL+GG NEVMSLH+ G L+P+L +A A+W Sbjct: 61 CSPAVPAVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALW 101 >gb|ACH63240.1| glutaredoxin [Rheum australe] Length = 106 Score = 135 bits (341), Expect = 3e-30 Identities = 64/101 (63%), Positives = 81/101 (80%) Frame = +1 Query: 10 MATVTRLGTEYPVVIFSKSSCCMSHSIKTLISSFGANPAVYELDEMPNGQQMERELKALG 189 M V L E VVIFSK+SCC+SHS+K LIS +GANP VYELDEMPNGQ++E+ LK +G Sbjct: 1 MDVVRELVHEKAVVIFSKNSCCISHSMKQLISGYGANPIVYELDEMPNGQEIEKVLKKMG 60 Query: 190 RKPIIPAVFIGKELIGGPNEVMSLHVKGKLVPLLLQAKAIW 312 KP +PAVFIG+ +GG NEV+SL V+G LVP+L++A+AIW Sbjct: 61 CKPSVPAVFIGERFVGGANEVISLQVQGNLVPMLMEARAIW 101 >ref|XP_004143084.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis sativus] gi|449524844|ref|XP_004169431.1| PREDICTED: monothiol glutaredoxin-S2-like [Cucumis sativus] Length = 102 Score = 134 bits (338), Expect = 7e-30 Identities = 61/101 (60%), Positives = 80/101 (79%) Frame = +1 Query: 10 MATVTRLGTEYPVVIFSKSSCCMSHSIKTLISSFGANPAVYELDEMPNGQQMERELKALG 189 M TV +L ++ PVV+FSK+SCCMSHSIKTL+ FG NP VYELDE+P G+++E+ L +G Sbjct: 1 METVNKLVSDRPVVVFSKNSCCMSHSIKTLLCDFGVNPTVYELDELPRGKEIEQALLRIG 60 Query: 190 RKPIIPAVFIGKELIGGPNEVMSLHVKGKLVPLLLQAKAIW 312 P +PAVFIG EL+GG NEVMSLH+K L+P+L +A A+W Sbjct: 61 CNPAVPAVFIGGELVGGANEVMSLHLKRNLIPMLRKAGALW 101 >ref|NP_197361.1| monothiol glutaredoxin-S2 [Arabidopsis thaliana] gi|75154460|sp|Q8L8Z8.1|GRXS2_ARATH RecName: Full=Monothiol glutaredoxin-S2; Short=AtGrxS2; AltName: Full=Protein ROXY 10 gi|21617983|gb|AAM67033.1| glutaredoxin-like protein [Arabidopsis thaliana] gi|26450155|dbj|BAC42196.1| putative glutaredoxin [Arabidopsis thaliana] gi|28827410|gb|AAO50549.1| putative glutaredoxin [Arabidopsis thaliana] gi|226348198|gb|ACO50415.1| glutaredoxin [Arabidopsis thaliana] gi|332005201|gb|AED92584.1| monothiol glutaredoxin-S2 [Arabidopsis thaliana] Length = 102 Score = 132 bits (332), Expect = 4e-29 Identities = 61/101 (60%), Positives = 79/101 (78%) Frame = +1 Query: 10 MATVTRLGTEYPVVIFSKSSCCMSHSIKTLISSFGANPAVYELDEMPNGQQMERELKALG 189 M +T++ E PVVI+SKSSCCMSH+IKTL+ FGANPAVYELDE+ G+++E+ L LG Sbjct: 1 MDMITKMVMERPVVIYSKSSCCMSHTIKTLLCDFGANPAVYELDEISRGREIEQALLRLG 60 Query: 190 RKPIIPAVFIGKELIGGPNEVMSLHVKGKLVPLLLQAKAIW 312 P +P VFIG EL+GG NEVMSLH+ G L+P+L +A A+W Sbjct: 61 CSPAVPGVFIGGELVGGANEVMSLHLNGSLIPMLKRAGALW 101