BLASTX nr result
ID: Bupleurum21_contig00024786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00024786 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 98 8e-19 ref|XP_002516618.1| pentatricopeptide repeat-containing protein,... 94 2e-17 ref|XP_002308636.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-14 ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-13 ref|NP_196692.1| pentatricopeptide repeat-containing protein [Ar... 78 9e-13 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 97.8 bits (242), Expect = 8e-19 Identities = 45/81 (55%), Positives = 62/81 (76%) Frame = -3 Query: 326 QYLTYQKMYDQLQKEGMADMSKKLSDLMASVPHSKNLPNTYIGDSSLSSERHTSAIQKAE 147 QYLT+++M + L+K G+ +M++KL D+MASVPHS LPNTY GD S R TS IQ+AE Sbjct: 495 QYLTFERMNNALRKRGLTEMARKLCDMMASVPHSSKLPNTYSGDGDASRARKTSIIQRAE 554 Query: 146 VMSKILKTSKNPKDIMKQRSS 84 MS ILKT +P++++K+RSS Sbjct: 555 AMSDILKTCNDPRELVKRRSS 575 >ref|XP_002516618.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544438|gb|EEF45959.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 577 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/82 (53%), Positives = 64/82 (78%), Gaps = 1/82 (1%) Frame = -3 Query: 326 QYLTYQKMYDQLQKEGMADMSKKLSDLMASVPHSKNLPNTY-IGDSSLSSERHTSAIQKA 150 QYLT+Q++ D+L+K GM + ++KLSD+M+SVPHS NLPNTY + +L R +S +QKA Sbjct: 474 QYLTFQRLNDELRKRGMVERARKLSDMMSSVPHSTNLPNTYSVEGDALRRARRSSILQKA 533 Query: 149 EVMSKILKTSKNPKDIMKQRSS 84 E MSKILKT +P++++K +SS Sbjct: 534 EAMSKILKTCNDPRELVKLKSS 555 >ref|XP_002308636.1| predicted protein [Populus trichocarpa] gi|222854612|gb|EEE92159.1| predicted protein [Populus trichocarpa] Length = 607 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/82 (48%), Positives = 60/82 (73%), Gaps = 1/82 (1%) Frame = -3 Query: 326 QYLTYQKMYDQLQKEGMADMSKKLSDLMASVPHSKNLPNTYIGDSSLSSE-RHTSAIQKA 150 QYLT+ ++ D+ +K+G+ +++++L LM+SV HSKNLPNTY D S R S +QKA Sbjct: 505 QYLTFHRLNDEFRKQGLTELARRLCKLMSSVSHSKNLPNTYNVDRDASRHARRKSILQKA 564 Query: 149 EVMSKILKTSKNPKDIMKQRSS 84 VMS+ILKT +P++++K RSS Sbjct: 565 GVMSEILKTCNDPRELVKHRSS 586 >ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] gi|449503560|ref|XP_004162063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] Length = 615 Score = 79.3 bits (194), Expect = 3e-13 Identities = 35/80 (43%), Positives = 57/80 (71%) Frame = -3 Query: 326 QYLTYQKMYDQLQKEGMADMSKKLSDLMASVPHSKNLPNTYIGDSSLSSERHTSAIQKAE 147 QYLT+ +++D+ K G+ M+ KL ++M+SVPHS+ LP+TY R TS ++KAE Sbjct: 511 QYLTFCRLHDEFMKRGLTKMASKLQEMMSSVPHSEKLPDTYNQTPDSIRARRTSIMRKAE 570 Query: 146 VMSKILKTSKNPKDIMKQRS 87 MS++LK K+P++++K+RS Sbjct: 571 AMSEMLKVCKDPRELVKRRS 590 >ref|NP_196692.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75174149|sp|Q9LFM6.1|PP375_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g11310, mitochondrial; Flags: Precursor gi|8953393|emb|CAB96666.1| putative protein [Arabidopsis thaliana] gi|110738090|dbj|BAF00978.1| hypothetical protein [Arabidopsis thaliana] gi|332004275|gb|AED91658.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 602 Score = 77.8 bits (190), Expect = 9e-13 Identities = 37/83 (44%), Positives = 58/83 (69%), Gaps = 2/83 (2%) Frame = -3 Query: 326 QYLTYQKMYDQLQKEGMADMSKKLSDLMASVPHSKNLPNTY--IGDSSLSSERHTSAIQK 153 QY+T++ + + L+ +GM+DM+K+LS LM+S+PHSK LPNTY D+ +R S + + Sbjct: 494 QYITFKMIDNGLRSKGMSDMAKRLSSLMSSLPHSKKLPNTYREAVDAPPDKDRRKSILHR 553 Query: 152 AEVMSKILKTSKNPKDIMKQRSS 84 AE MS +LK +NP+ ++K R S Sbjct: 554 AEAMSDVLKGCRNPRKLVKMRGS 576