BLASTX nr result
ID: Bupleurum21_contig00024551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00024551 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282782.1| PREDICTED: ribosomal RNA processing protein ... 135 3e-30 ref|XP_002509710.1| conserved hypothetical protein [Ricinus comm... 130 1e-28 ref|XP_003521510.1| PREDICTED: ribosomal RNA processing protein ... 127 9e-28 ref|XP_004141535.1| PREDICTED: ribosomal RNA processing protein ... 127 1e-27 gb|ACU21223.1| unknown [Glycine max] 127 1e-27 >ref|XP_002282782.1| PREDICTED: ribosomal RNA processing protein 36 homolog [Vitis vinifera] gi|297742597|emb|CBI34746.3| unnamed protein product [Vitis vinifera] Length = 236 Score = 135 bits (340), Expect = 3e-30 Identities = 65/85 (76%), Positives = 72/85 (84%), Gaps = 1/85 (1%) Frame = -3 Query: 252 ADVTFEELQKARCDGSHTVYKKPNLQNTS-RANKNRPMEVTSKKPVGRFKEVIQVPKKVV 76 ADVTFEELQKAR DGSH+VY+ P + R NKNRPMEV+SKKPV RF+E IQVPK+VV Sbjct: 30 ADVTFEELQKARSDGSHSVYRMPKSEKKGGRPNKNRPMEVSSKKPVSRFRETIQVPKRVV 89 Query: 75 RDPRFESLCGELDVDGFKKRYNFLY 1 RDPRFESLCG LD DGF+KRYNFLY Sbjct: 90 RDPRFESLCGTLDADGFRKRYNFLY 114 >ref|XP_002509710.1| conserved hypothetical protein [Ricinus communis] gi|223549609|gb|EEF51097.1| conserved hypothetical protein [Ricinus communis] Length = 252 Score = 130 bits (326), Expect = 1e-28 Identities = 63/85 (74%), Positives = 72/85 (84%), Gaps = 1/85 (1%) Frame = -3 Query: 252 ADVTFEELQKARCDGSHTVYKKPNLQNT-SRANKNRPMEVTSKKPVGRFKEVIQVPKKVV 76 AD TFEELQKAR +GS +V++KP + RANKNRPMEV+ KKPV RF+EV Q PKKVV Sbjct: 46 ADATFEELQKARSNGSISVHQKPKQEKKPGRANKNRPMEVSCKKPVSRFREVFQAPKKVV 105 Query: 75 RDPRFESLCGELDVDGFKKRYNFLY 1 RDPRFESLCG+LDVDGF+KRYNFLY Sbjct: 106 RDPRFESLCGQLDVDGFRKRYNFLY 130 >ref|XP_003521510.1| PREDICTED: ribosomal RNA processing protein 36 homolog [Glycine max] Length = 250 Score = 127 bits (319), Expect = 9e-28 Identities = 62/85 (72%), Positives = 70/85 (82%), Gaps = 1/85 (1%) Frame = -3 Query: 252 ADVTFEELQKARCDGSHTVYKKPNLQ-NTSRANKNRPMEVTSKKPVGRFKEVIQVPKKVV 76 ADVTFEELQKAR +G+H ++KP RANKNRPME +SKKPV F+EVIQ PKKVV Sbjct: 44 ADVTFEELQKARSNGAHAFFQKPKEDIKLKRANKNRPMEASSKKPVTGFREVIQAPKKVV 103 Query: 75 RDPRFESLCGELDVDGFKKRYNFLY 1 RDPRFESLCG+LD DGF+KRYNFLY Sbjct: 104 RDPRFESLCGKLDPDGFRKRYNFLY 128 >ref|XP_004141535.1| PREDICTED: ribosomal RNA processing protein 36 homolog [Cucumis sativus] gi|449481495|ref|XP_004156200.1| PREDICTED: ribosomal RNA processing protein 36 homolog [Cucumis sativus] Length = 253 Score = 127 bits (318), Expect = 1e-27 Identities = 61/85 (71%), Positives = 72/85 (84%), Gaps = 1/85 (1%) Frame = -3 Query: 252 ADVTFEELQKARCDGSHTVYKKPNLQNTS-RANKNRPMEVTSKKPVGRFKEVIQVPKKVV 76 ADVTFEELQ+AR DGSH++Y+K + S RANKNRPMEV+S+KPV RF+EVIQ PK +V Sbjct: 44 ADVTFEELQRARSDGSHSMYQKTKQEKKSGRANKNRPMEVSSRKPVSRFREVIQAPKNMV 103 Query: 75 RDPRFESLCGELDVDGFKKRYNFLY 1 RDPRFESL G LD DGFKKRY+F+Y Sbjct: 104 RDPRFESLSGTLDADGFKKRYSFIY 128 >gb|ACU21223.1| unknown [Glycine max] Length = 250 Score = 127 bits (318), Expect = 1e-27 Identities = 61/85 (71%), Positives = 71/85 (83%), Gaps = 1/85 (1%) Frame = -3 Query: 252 ADVTFEELQKARCDGSHTVYKKPNL-QNTSRANKNRPMEVTSKKPVGRFKEVIQVPKKVV 76 ADVTFEELQKAR +G+H ++KP + RANKNRPME +SKKPV F+EVIQ PKKVV Sbjct: 44 ADVTFEELQKARSNGTHAFFQKPKEDKKLKRANKNRPMEASSKKPVSGFREVIQAPKKVV 103 Query: 75 RDPRFESLCGELDVDGFKKRYNFLY 1 RDPRFESLCG+LD +GF+KRYNFLY Sbjct: 104 RDPRFESLCGKLDPEGFRKRYNFLY 128