BLASTX nr result
ID: Bupleurum21_contig00023982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00023982 (1048 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31517.3| unnamed protein product [Vitis vinifera] 59 2e-06 emb|CAN75604.1| hypothetical protein VITISV_016383 [Vitis vinifera] 59 2e-06 >emb|CBI31517.3| unnamed protein product [Vitis vinifera] Length = 785 Score = 58.9 bits (141), Expect = 2e-06 Identities = 36/84 (42%), Positives = 46/84 (54%), Gaps = 3/84 (3%) Frame = -1 Query: 280 THRKMSPDQHTKGALRDASPVSAELPKSSKPSGLRMPSPKIGFFDENSMVPTSTDTLHFQ 101 +HR P+Q+ K PVS + +SKPS LRMPSPKIGFFD +PT + FQ Sbjct: 496 SHRTRLPNQYIKKCSMVNGPVSPNVSGNSKPSSLRMPSPKIGFFDVEKSMPTGLNG-SFQ 554 Query: 100 FRSQNASSDPNINT---NIRGPSN 38 FRS S+ T N+ G +N Sbjct: 555 FRSGAQSTLAKSGTRISNLSGAAN 578 >emb|CAN75604.1| hypothetical protein VITISV_016383 [Vitis vinifera] Length = 760 Score = 58.9 bits (141), Expect = 2e-06 Identities = 36/84 (42%), Positives = 46/84 (54%), Gaps = 3/84 (3%) Frame = -1 Query: 280 THRKMSPDQHTKGALRDASPVSAELPKSSKPSGLRMPSPKIGFFDENSMVPTSTDTLHFQ 101 +HR P+Q+ K PVS + +SKPS LRMPSPKIGFFD +PT + FQ Sbjct: 465 SHRTRLPNQYIKKCSMVNGPVSPNVSGNSKPSSLRMPSPKIGFFDVEKSMPTGLNG-SFQ 523 Query: 100 FRSQNASSDPNINT---NIRGPSN 38 FRS S+ T N+ G +N Sbjct: 524 FRSGAQSTLAKSGTRISNLSGAAN 547