BLASTX nr result
ID: Bupleurum21_contig00023917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00023917 (694 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314700.1| predicted protein [Populus trichocarpa] gi|2... 59 9e-07 ref|XP_002282293.1| PREDICTED: 5'-nucleotidase surE [Vitis vinif... 57 3e-06 >ref|XP_002314700.1| predicted protein [Populus trichocarpa] gi|222863740|gb|EEF00871.1| predicted protein [Populus trichocarpa] Length = 247 Score = 58.9 bits (141), Expect = 9e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 3 TIMVTNDDGIDGAGLRALVQLLVSMDQYQVFVCAPES 113 TIMVTNDDGID GLRALVQ+LVS ++QV VCAP+S Sbjct: 6 TIMVTNDDGIDAPGLRALVQVLVSTRRFQVLVCAPDS 42 >ref|XP_002282293.1| PREDICTED: 5'-nucleotidase surE [Vitis vinifera] gi|297737043|emb|CBI26244.3| unnamed protein product [Vitis vinifera] Length = 308 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 6 IMVTNDDGIDGAGLRALVQLLVSMDQYQVFVCAPES 113 IMVTNDDGID GLRALVQ+LVS + Y+V VCAP+S Sbjct: 13 IMVTNDDGIDAPGLRALVQVLVSTNLYEVLVCAPDS 48