BLASTX nr result
ID: Bupleurum21_contig00023718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00023718 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001149117.1| ADP-ribosylation factor [Zea mays] gi|242054... 56 3e-06 gb|ABF74733.1| ADP-ribosylation factor 1 [Nicotiana benthamiana] 56 3e-06 ref|XP_001764700.1| predicted protein [Physcomitrella patens sub... 55 5e-06 ref|XP_004161090.1| PREDICTED: ADP-ribosylation factor 1-like [C... 55 6e-06 gb|AAF65512.1| ADP-ribosylation factor [Capsicum annuum] gi|3779... 55 6e-06 >ref|NP_001149117.1| ADP-ribosylation factor [Zea mays] gi|242054753|ref|XP_002456522.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor] gi|194699598|gb|ACF83883.1| unknown [Zea mays] gi|194707852|gb|ACF88010.1| unknown [Zea mays] gi|195624848|gb|ACG34254.1| ADP-ribosylation factor [Zea mays] gi|195645320|gb|ACG42128.1| ADP-ribosylation factor [Zea mays] gi|241928497|gb|EES01642.1| hypothetical protein SORBIDRAFT_03g037760 [Sorghum bicolor] gi|414880022|tpg|DAA57153.1| TPA: ADP-ribosylation factor [Zea mays] Length = 181 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 3 STCATSGEGLYEGLDWLSNNIANKS 77 STCATSGEGLYEGLDWLSNNIANKS Sbjct: 157 STCATSGEGLYEGLDWLSNNIANKS 181 >gb|ABF74733.1| ADP-ribosylation factor 1 [Nicotiana benthamiana] Length = 181 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 3 STCATSGEGLYEGLDWLSNNIANKS 77 STCATSGEGLYEGLDWLSNNIANKS Sbjct: 157 STCATSGEGLYEGLDWLSNNIANKS 181 >ref|XP_001764700.1| predicted protein [Physcomitrella patens subsp. patens] gi|162683994|gb|EDQ70399.1| predicted protein [Physcomitrella patens subsp. patens] Length = 190 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 3 STCATSGEGLYEGLDWLSNNIANKS*WHNFP 95 STCATSGEGLYEGLDWLS+NIANK H+ P Sbjct: 157 STCATSGEGLYEGLDWLSSNIANKIGCHDVP 187 >ref|XP_004161090.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus] Length = 182 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 STCATSGEGLYEGLDWLSNNIANKS 77 STCATSGEGLYEGLDWLSNNIANK+ Sbjct: 136 STCATSGEGLYEGLDWLSNNIANKA 160 >gb|AAF65512.1| ADP-ribosylation factor [Capsicum annuum] gi|37791223|gb|AAR03592.1| ARF-like small GTPase [Brassica juncea] Length = 181 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 STCATSGEGLYEGLDWLSNNIANKS 77 STCATSGEGLYEGLDWLSNNIANK+ Sbjct: 157 STCATSGEGLYEGLDWLSNNIANKA 181